Oall_contig40263_v2
| Name | Oall_contig40263_v2 |
|---|---|
| Accession | ID7192960 |
| Sequence | GGGCTAATCATAATTTTATTTTTTTTCTATATTTCAGTTCCCGTTGCGAA |
| Length | 454 |
| Type | contig |
| Organism | Oak |
[-] Collapse All
References
| Dababase | Accession |
|---|---|
| GFF_source | SeqManPro |
ESTs in this contig
| Type | Feature | Position | ||
|---|---|---|---|---|
| EST | WOA_090084_1334_0958 | 0-282 | ||
| EST | ROA_035865_2628_3514 | 201-454 | ||
| microsatellite | Oall_contig40263_v2-ssr231 | 230 | 254 | 0 |
InterProScan Analysis
Analysis Date: 11-20-2009
(Interpro: Oall_contigs_v2)
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Loading...

Blast Hits to Contigs V2 AC454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_AC454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
AC454_contig3540_v2 | 1.74834e-26 | 97.62% | ||
AC454_contig3540_v2 | ||||
HSP 1 Score: 108.288 bits (230), Expect = 1.74834e-26 Query: 297 QVAKNCPLSCT*SNN**HHGCFLLELDQWYYFVPLEIYGCGK 422 HSP 2 Score: 26.2688 bits (51), Expect = 1.74834e-26 Query: 421 KTCPVKTKQNK 453 HSP 3 Score: 98.6658 bits (209), Expect = 1.02638e-24 Query: 299 FPQP*ISSGTK*YHWSSSSKKQPWCY*LLLYVQESGQFLAT 421 HSP 4 Score: 29.9345 bits (59), Expect = 1.02638e-24 Query: 419 FYSV*FLLDRFF 454 HSP 5 Score: 93.6255 bits (198), Expect = 3.92304e-22 Query: 282 FSTTIDFKRYKIIPLVKLKQEATMVLLVITLCTRKWTIFSYLYFNFF 422 HSP 6 Score: 26.2688 bits (51), Expect = 3.92304e-22 Query: 420 LFCLVFTGQVF 452 HSP 7 Score: 93.1672 bits (197), Expect = 7.3323e-22 Query: 310 FFHNHRFQAVQNNTIGQAQARSNHGVISYYFMYKKVDN 423 HSP 8 Score: 25.8106 bits (50), Expect = 7.3323e-22 Query: 421 FILFSFYWTGF 453 HSP 9 Score: 90.8762 bits (192), Expect = 1.22176e-20 Query: 284 KN*NTSS*KLSTFLYIK**LITPWLLLA*A*PMVLFCTA*NLWLWK 421 HSP 10 Score: 23.9778 bits (46), Expect = 1.22176e-20 Query: 420 KNLSSKN*TE* 452 HSP 11 Score: 78.9628 bits (166), Expect = 1.03965e-16 Query: 310 IVHFLVHKVITNNTMVASCLSLTNGIILYRLKSMVVEK 423 HSP 12 Score: 22.6031 bits (43), Expect = 1.03965e-16 Query: 419 KKPVQ*KLNRIK 454 | ||||
Loading...

Blast Hits to Contigs V2 CC454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_CC454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CC454_contig42162_v2 | 4.09814e-20 | 100.00% | ||
CC454_contig42162_v2 | ||||
HSP 1 Score: 83.0867 bits (175), Expect = 4.09814e-20 Query: 323 FPQP*ISSGTK*YHWSSSSKKQPWCY*LLLYVQ 421 HSP 2 Score: 29.9345 bits (59), Expect = 4.09814e-20 Query: 419 FYSV*FLLDRFF 454 HSP 3 Score: 83.0867 bits (175), Expect = 4.98253e-19 Query: 324 CT*SNN**HHGCFLLELDQWYYFVPLEIYGCGK 422 HSP 4 Score: 26.2688 bits (51), Expect = 4.98253e-19 Query: 421 KTCPVKTKQNK 453 HSP 5 Score: 78.5046 bits (165), Expect = 1.1281e-17 Query: 322 FFHNHRFQAVQNNTIGQAQARSNHGVISYYFMYK 423 HSP 6 Score: 26.2688 bits (51), Expect = 1.1281e-17 Query: 420 LFCLVFTGQVF 452 HSP 7 Score: 69.7986 bits (146), Expect = 5.72243e-15 Query: 324 FSTTIDFKRYKIIPLVKLKQEATMVLLVITLCT 422 HSP 8 Score: 25.8106 bits (50), Expect = 5.72243e-15 Query: 421 FILFSFYWTGF 453 HSP 9 Score: 68.424 bits (143), Expect = 5.04361e-14 Query: 323 LYIK**LITPWLLLA*A*PMVLFCTA*NLWLWK 421 HSP 10 Score: 23.9778 bits (46), Expect = 5.04361e-14 Query: 420 KNLSSKN*TE* 452 HSP 11 Score: 68.424 bits (143), Expect = 1.28088e-13 Query: 322 LVHKVITNNTMVASCLSLTNGIILYRLKSMVVEK 423 HSP 12 Score: 22.6031 bits (43), Expect = 1.28088e-13 Query: 419 KKPVQ*KLNRIK 454 | ||||
Loading...

Blast Hits to Contigs V2 CCall
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_CCall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CCall_contig13839_v2 | 1.98564e-24 | 100.00% | ||
CCall_contig13839_v2 | ||||
HSP 1 Score: 98.6658 bits (209), Expect = 1.98564e-24 Query: 302 FPQP*ISSGTK*YHWSSSSKKQPWCY*LLLYVQESGQFLA 421 HSP 2 Score: 29.9345 bits (59), Expect = 1.98564e-24 Query: 419 FYSV*FLLDRFF 454 HSP 3 Score: 101.415 bits (215), Expect = 3.71416e-24 Query: 300 VAKNCPLSCT*SNN**HHGCFLLELDQWYYFVPLEIYGCGK 422 HSP 4 Score: 26.2688 bits (51), Expect = 3.71416e-24 Query: 421 KTCPVKTKQNK 453 HSP 5 Score: 88.127 bits (186), Expect = 3.22791e-20 Query: 310 FFHNHRFQAVQNNTIGQAQARSNHGVISYYFMYKKVDN 423 HSP 6 Score: 26.2688 bits (51), Expect = 3.22791e-20 Query: 420 LFCLVFTGQVF 452 HSP 7 Score: 88.127 bits (186), Expect = 4.41154e-20 Query: 303 FSTTIDFKRYKIIPLVKLKQEATMVLLVITLCTRKWTIFS 422 HSP 8 Score: 25.8106 bits (50), Expect = 4.41154e-20 Query: 421 FILFSFYWTGF 453 HSP 9 Score: 81.712 bits (172), Expect = 1.21469e-17 Query: 302 S*KLSTFLYIK**LITPWLLLA*A*PMVLFCTA*NLWLWK 421 HSP 10 Score: 23.9778 bits (46), Expect = 1.21469e-17 Query: 420 KNLSSKN*TE* 452 HSP 11 Score: 78.5046 bits (165), Expect = 2.74143e-16 Query: 310 IVHFLVHKVITNNTMVASCLSLTNGIILYRLKSMVVEK 423 HSP 12 Score: 22.6031 bits (43), Expect = 2.74143e-16 Query: 419 KKPVQ*KLNRIK 454 | ||||
tags