Oall_contig21812_v2
| Name | Oall_contig21812_v2 |
|---|---|
| Accession | ID7011395 |
| Sequence | GATATCTTTCACTAACTGAGCCCTTTATTGCATTTTTAAAACTAAAACAT |
| Length | 372 |
| Type | contig |
| Organism | Oak |
[-] Collapse All
References
| Dababase | Accession |
|---|---|
| GFF_source | SeqManPro |
ESTs in this contig
| Type | Feature | Position | ||
|---|---|---|---|---|
| EST | ROA_142857_2949_3040 | 0-285 | ||
| EST | ROB_035687_1249_3567 | 119-372 | ||
| EST | ROB_072880_1367_1216 | 122-335 | ||
| microsatellite | Oall_contig21812_v2-ssr219 | 218 | 230 | 0 |
| microsatellite | Oall_contig21812_v2-ssr267 | 266 | 278 | 0 |
GO terms assigned to this feature
| Accession | Category | Term |
|---|---|---|
| GO:0009664 | biological_process | plant-type cell wall organization |
| GO:0005199 | molecular_function | structural constituent of cell wall |
InterProScan Analysis
Analysis Date: 11-20-2009
(Interpro: Oall_contigs_v2)
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Loading...

Blast Hits to Contigs V2 AC454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_AC454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
AC454_contig17422_v2 | 3.09032e-23 | 84.85% | ||
AC454_contig17422_v2 | ||||
HSP 1 Score: 68.424 bits (143), Expect = 3.09032e-23 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 2 Score: 43.6807 bits (89), Expect = 3.09032e-23 Query: 130 RTIQVLIPTXTTI*VQVXTTTXXXSSSTI 216 HSP 3 Score: 28.5598 bits (56), Expect = 3.09032e-23 Query: 95 LXLHHMSTXPHHLRNTH 145 HSP 4 Score: 66.5912 bits (139), Expect = 1.73633e-16 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLII 92 HSP 5 Score: 35.433 bits (71), Expect = 1.73633e-16 Query: 111 WWGXVLIWWRXXXH 152 HSP 6 Score: 63.8419 bits (133), Expect = 1.85772e-16 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 7 Score: 28.5598 bits (56), Expect = 1.85772e-16 Query: 130 TTI*VQVXTTTXXXSSSTI 186 HSP 8 Score: 27.1852 bits (53), Expect = 1.85772e-16 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 9 Score: 56.0524 bits (116), Expect = 6.2658e-13 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 10 Score: 32.2255 bits (64), Expect = 6.2658e-13 Query: 99 VFRRWWGXVLIWWR 140 HSP 11 Score: 54.2195 bits (112), Expect = 2.6411e-12 Query: 4 IFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 12 Score: 33.6001 bits (67), Expect = 2.6411e-12 Query: 87 IIEWVFRRWWGXVLIWWR 140 HSP 13 Score: 61.5509 bits (128), Expect = 6.8466e-12 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 14 Score: 24.8942 bits (48), Expect = 6.8466e-12 Query: 110 LXLHHMSTXPHH 145 | ||||
Loading...

Blast Hits to Contigs V2 CC454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_CC454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CC454_contig19675_v2 | 1.23566e-23 | 84.85% | ||
CC454_contig19675_v2 | ||||
HSP 1 Score: 68.424 bits (143), Expect = 1.23566e-23 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 2 Score: 45.9718 bits (94), Expect = 1.23566e-23 Query: 130 RTIQVLIPTXTTI*VQVXTTTXXXSSSTI 216 HSP 3 Score: 28.5598 bits (56), Expect = 1.23566e-23 Query: 95 LXLHHMSTXPHHLRNTH 145 HSP 4 Score: 63.8419 bits (133), Expect = 6.15789e-19 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 5 Score: 40.0151 bits (81), Expect = 6.15789e-19 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 6 Score: 26.727 bits (52), Expect = 6.15789e-19 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 7 Score: 66.5912 bits (139), Expect = 2.00554e-16 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLII 92 HSP 8 Score: 31.3091 bits (62), Expect = 2.00554e-16 Query: 87 IIEWVFRRWWGXVLIWW 137 HSP 9 Score: 23.9778 bits (46), Expect = 2.00554e-16 Query: 122 CTHMVEEE 145 HSP 10 Score: 61.5509 bits (128), Expect = 4.4022e-15 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 11 Score: 31.3091 bits (62), Expect = 4.4022e-15 Query: 124 TTI*VQVXTTTXXXSSSTI*V 186 HSP 12 Score: 24.436 bits (47), Expect = 4.4022e-15 Query: 92 HHMSTXPHHLRNTHS 136 HSP 13 Score: 56.0524 bits (116), Expect = 1.17467e-12 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 14 Score: 32.2255 bits (64), Expect = 1.17467e-12 Query: 99 VFRRWWGXVLIWWR 140 HSP 15 Score: 54.2195 bits (112), Expect = 7.22954e-11 Query: 4 IFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 16 Score: 30.3927 bits (60), Expect = 7.22954e-11 Query: 99 VFRRWWGXVLIWW 137 | ||||
CC454_contig3732_v2 | 6.35648e-12 | 81.25% | ||
CC454_contig3732_v2 | ||||
HSP 1 Score: 45.5136 bits (93), Expect = 6.35648e-12 Query: 124 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI*V 219 HSP 2 Score: 34.5166 bits (69), Expect = 6.35648e-12 Query: 340 CCKQCGFSLW* 372 HSP 3 Score: 24.436 bits (47), Expect = 6.35648e-12 Query: 92 LXLHHMSTXPHHLRNTHS 145 | ||||
Loading...

Blast Hits to Contigs V2 CCall
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_CCall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CCall_contig6670_v2 | 1.27297e-23 | 84.85% | ||
CCall_contig6670_v2 | ||||
HSP 1 Score: 68.424 bits (143), Expect = 1.27297e-23 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 2 Score: 45.9718 bits (94), Expect = 1.27297e-23 Query: 130 RTIQVLIPTXTTI*VQVXTTTXXXSSSTI 216 HSP 3 Score: 28.5598 bits (56), Expect = 1.27297e-23 Query: 95 LXLHHMSTXPHHLRNTH 145 HSP 4 Score: 63.8419 bits (133), Expect = 2.64904e-18 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 5 Score: 41.3897 bits (84), Expect = 2.64904e-18 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 6 Score: 23.9778 bits (46), Expect = 2.64904e-18 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 7 Score: 61.5509 bits (128), Expect = 8.87427e-16 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 8 Score: 31.3091 bits (62), Expect = 8.87427e-16 Query: 124 TTI*VQVXTTTXXXSSSTI*V 186 HSP 9 Score: 27.6434 bits (54), Expect = 8.87427e-16 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 10 Score: 66.5912 bits (139), Expect = 9.57708e-16 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLII 92 HSP 11 Score: 32.2255 bits (64), Expect = 9.57708e-16 Query: 99 VFRRWWGXVLIWWR 140 HSP 12 Score: 56.0524 bits (116), Expect = 4.36798e-12 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 13 Score: 33.1419 bits (66), Expect = 4.36798e-12 Query: 87 IIEWVFRRWWGXVLIWWR 140 HSP 14 Score: 54.2195 bits (112), Expect = 9.63563e-11 Query: 4 IFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 15 Score: 30.3927 bits (60), Expect = 9.63563e-11 Query: 99 VFRRWWGXVLIWW 137 | ||||
CCall_contig3850_v2 | 1.03331e-13 | 76.67% | ||
CCall_contig3850_v2 | ||||
HSP 1 Score: 47.8046 bits (98), Expect = 1.03331e-13 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 2 Score: 34.5166 bits (69), Expect = 1.03331e-13 Query: 340 CCKQCGFSLW* 372 HSP 3 Score: 28.5598 bits (56), Expect = 1.03331e-13 Query: 92 LXLHHMSTXPHHLRNTHS 145 | ||||
Loading...

Blast Hits to Contig V2 RO454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_RO454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
RO454_contig26104_v2 | 1.22643e-30 | 100.00% | ||
RO454_contig26104_v2 | ||||
HSP 1 Score: 87.2105 bits (184), Expect = 1.22643e-30 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLIIEWV 101 HSP 2 Score: 41.8479 bits (85), Expect = 1.22643e-30 Query: 329 KDKHHQRLNPHCLQ 370 HSP 3 Score: 37.724 bits (76), Expect = 1.22643e-30 Query: 99 VFRRWWGXVLIWW 137 HSP 4 Score: 81.2538 bits (171), Expect = 3.33583e-30 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 5 Score: 38.1822 bits (77), Expect = 3.33583e-30 Query: 327 VASNVGSVSGDAYPY 371 HSP 6 Score: 36.8076 bits (74), Expect = 3.33583e-30 Query: 95 HHMSTXPHHLRNTH 136 HSP 7 Score: 25.3524 bits (49), Expect = 3.33583e-30 Query: 124 IQVLIPTXTTI*VQVXTTTXXXSSSTI*V 210 HSP 8 Score: 70.2568 bits (147), Expect = 1.22549e-21 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 9 Score: 39.5569 bits (80), Expect = 1.22549e-21 Query: 318 WXXIRISITRD*THIACN 371 HSP 10 Score: 26.2688 bits (51), Expect = 1.22549e-21 Query: 99 VFRRWWGXVLIWW 137 HSP 11 Score: 72.0897 bits (151), Expect = 4.92106e-20 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 12 Score: 34.5166 bits (69), Expect = 4.92106e-20 Query: 340 CCKQCGFSLW* 372 HSP 13 Score: 23.9778 bits (46), Expect = 4.92106e-20 Query: 130 TTI*VQVXTTTXXXSSSTI 186 HSP 14 Score: 65.6747 bits (137), Expect = 3.6222e-18 Query: 1 DIFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 15 Score: 33.6001 bits (67), Expect = 3.6222e-18 Query: 328 *G*ASPETEPTLLAT 372 HSP 16 Score: 24.8942 bits (48), Expect = 3.6222e-18 Query: 99 VFRRWWGXVLI 131 HSP 17 Score: 67.0494 bits (140), Expect = 2.79462e-16 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 18 Score: 33.6001 bits (67), Expect = 2.79462e-16 Query: 329 LQAMWVQSLVMLIL 370 | ||||
RO454_contig15019_v2 | 9.46224e-29 | 95.56% | ||
RO454_contig15019_v2 | ||||
HSP 1 Score: 122.034 bits (260), Expect = 9.46224e-29 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLIIEWVFRRWWGXVLIWW 137 HSP 2 Score: 109.205 bits (232), Expect = 6.88907e-25 Query: 2 HHMSTXPHHLRNTHSIISLERSTTCQYQLCFSFKNAIKGSVSERY 136 HSP 3 Score: 108.288 bits (230), Expect = 1.30026e-24 Query: 1 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI*VXXXXXXXXXXX**AWNVRPRANTNYVLVLKMQ*RAQLVKDI 219 HSP 4 Score: 65.6747 bits (137), Expect = 7.3067e-17 Query: 1 DIFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 5 Score: 34.9748 bits (70), Expect = 7.3067e-17 Query: 99 VFRRWWGXVLIWW 137 HSP 6 Score: 72.0897 bits (151), Expect = 2.53916e-16 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 7 Score: 26.727 bits (52), Expect = 2.53916e-16 Query: 110 HHMSTXPHH 136 HSP 8 Score: 78.5046 bits (165), Expect = 1.20164e-15 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYYXXXXXXXXXXCTHMVEEE 145 | ||||
RO454_contig15020_v2 | 4.40469e-21 | 95.45% | ||
RO454_contig15020_v2 | ||||
HSP 1 Score: 53.7613 bits (111), Expect = 4.40469e-21 Query: 35 THSIISLERSTTCQYQLCFSFK 100 HSP 2 Score: 43.6807 bits (89), Expect = 4.40469e-21 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 3 Score: 29.9345 bits (59), Expect = 4.40469e-21 Query: 110 LXLHHMSTXPHH 145 HSP 4 Score: 25.8106 bits (50), Expect = 4.40469e-21 Query: 2 LCFSFKNAIKGSVSERY 52 HSP 5 Score: 48.2628 bits (99), Expect = 4.33281e-19 Query: 21 LNNKLGTFDHVPIPIMF*F*KCNKG 95 HSP 6 Score: 34.9748 bits (70), Expect = 4.33281e-19 Query: 166 NRTIQVLIPTXTTI*VQV 219 HSP 7 Score: 29.0181 bits (57), Expect = 4.33281e-19 Query: 124 TTI*VQVXTTTXXXSSSTI*V 186 HSP 8 Score: 26.727 bits (52), Expect = 4.33281e-19 Query: 110 HHMSTXPHH 136 HSP 9 Score: 23.0613 bits (44), Expect = 4.33281e-19 Query: 1 KMQ*RAQLVKDI 36 HSP 10 Score: 60.6344 bits (126), Expect = 9.80203e-19 Query: 33 FLKLKHNWYWHVVERSKLIIEWV 101 HSP 11 Score: 34.9748 bits (70), Expect = 9.80203e-19 Query: 99 VFRRWWGXVLIWW 137 HSP 12 Score: 29.4763 bits (58), Expect = 9.80203e-19 Query: 2 ISFTN*ALYCIFKTK 46 HSP 13 Score: 43.6807 bits (89), Expect = 4.88019e-12 Query: 32 IFKTKT*LVLARGRTFQAYY 91 HSP 14 Score: 34.9748 bits (70), Expect = 4.88019e-12 Query: 99 VFRRWWGXVLIWW 137 HSP 15 Score: 26.2688 bits (51), Expect = 4.88019e-12 Query: 1 DIFH*LSPLLHF 36 HSP 16 Score: 44.1389 bits (90), Expect = 9.48379e-12 Query: 133 NRTIQVLIPTXTTI*VQVXTTTXXXSSST 219 HSP 17 Score: 40.0151 bits (81), Expect = 9.48379e-12 Query: 37 *AWNVRPRANTNYVLVL 87 | ||||
RO454_contig26951_v2 | 4.8941e-12 | 66.67% | ||
RO454_contig26951_v2 | ||||
HSP 1 Score: 41.8479 bits (85), Expect = 4.8941e-12 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 2 Score: 38.1822 bits (77), Expect = 4.8941e-12 Query: 327 VASNVGSVSGDAYPY 371 HSP 3 Score: 23.9778 bits (46), Expect = 4.8941e-12 Query: 98 HHMSTXPHHLRNT 136 | ||||
RO454_contig17513_v2 | 1.27703e-11 | 87.50% | ||
RO454_contig17513_v2 | ||||
HSP 1 Score: 51.9285 bits (107), Expect = 1.27703e-11 Query: 124 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI*V 219 HSP 2 Score: 31.7673 bits (63), Expect = 1.27703e-11 Query: 98 LXLHHMSTXPHHLRNT 145 | ||||
Loading...

Blast Hits to Contigs V2 WO454
Analysis Date: 11-18-2009 (Blast: Oall_contigs_v2_vs_WO454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
WO454_contig3958_v2 | 7.50112e-29 | 96.97% | ||
WO454_contig3958_v2 | ||||
HSP 1 Score: 78.9628 bits (166), Expect = 7.50112e-29 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 2 Score: 47.8046 bits (98), Expect = 7.50112e-29 Query: 127 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI* 219 HSP 3 Score: 36.8076 bits (74), Expect = 7.50112e-29 Query: 95 HHMSTXPHHLRNTH 136 HSP 4 Score: 85.3777 bits (180), Expect = 6.40415e-24 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLIIEWV 101 HSP 5 Score: 39.5569 bits (80), Expect = 6.40415e-24 Query: 99 VFRRWWGXVLIWW 137 HSP 6 Score: 69.3404 bits (145), Expect = 3.8414e-22 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 7 Score: 42.3061 bits (86), Expect = 3.8414e-22 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 8 Score: 29.0181 bits (57), Expect = 3.8414e-22 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 9 Score: 65.2165 bits (136), Expect = 9.74022e-20 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 10 Score: 41.3897 bits (84), Expect = 9.74022e-20 Query: 154 NRTIQVLIPTXTTI*VQVXTTT 219 HSP 11 Score: 25.8106 bits (50), Expect = 9.74022e-20 Query: 110 LXLHHMSTXPHH 145 HSP 12 Score: 66.1329 bits (138), Expect = 1.02149e-14 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 13 Score: 30.3927 bits (60), Expect = 1.02149e-14 Query: 114 WGXVLIWWRXXXH 152 HSP 14 Score: 62.9255 bits (131), Expect = 4.23029e-13 Query: 1 DIFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 15 Score: 28.1016 bits (55), Expect = 4.23029e-13 Query: 87 IIEWVFRRWWGXVLIWW 137 | ||||
WO454_contig15357_v2 | 8.42218e-26 | 96.97% | ||
WO454_contig15357_v2 | ||||
HSP 1 Score: 78.9628 bits (166), Expect = 8.42218e-26 Query: 2 THSIISLERSTTCQYQLCFSFKNAIKGSVSERY 100 HSP 2 Score: 42.3061 bits (86), Expect = 8.42218e-26 Query: 124 VLIPTXTTI*VQVXTTTXXXSSSTI*V 204 HSP 3 Score: 27.6434 bits (54), Expect = 8.42218e-26 Query: 92 LXLHHMSTXPHHLRNTHS 145 HSP 4 Score: 85.3777 bits (180), Expect = 1.48818e-22 Query: 3 YLSLTEPFIAFLKLKHNWYWHVVERSKLIIEWV 101 HSP 5 Score: 34.9748 bits (70), Expect = 1.48818e-22 Query: 99 VFRRWWGXVLIWW 137 HSP 6 Score: 69.3404 bits (145), Expect = 8.75689e-21 Query: 3 LNNKLGTFDHVPIPIMF*F*KCNKGLS**KI 95 HSP 7 Score: 45.0554 bits (92), Expect = 8.75689e-21 Query: 133 NRTIQVLIPTXTTI*VQVXTTTXXXSSST 219 HSP 8 Score: 65.2165 bits (136), Expect = 2.235e-17 Query: 1 *AWNVRPRANTNYVLVLKMQ*RAQLVKDI 87 HSP 9 Score: 28.1016 bits (55), Expect = 2.235e-17 Query: 130 TTI*VQVXTTTXXXSSSTI 186 HSP 10 Score: 26.727 bits (52), Expect = 2.235e-17 Query: 110 HHMSTXPHH 136 HSP 11 Score: 66.1329 bits (138), Expect = 1.87e-16 Query: 2 ISFTN*ALYCIFKTKT*LVLARGRTFQAYY 91 HSP 12 Score: 33.6001 bits (67), Expect = 1.87e-16 Query: 87 IIEWVFRRWWGXVLIWWR 140 HSP 13 Score: 62.9255 bits (131), Expect = 3.30824e-15 Query: 1 DIFH*LSPLLHF*N*NIIGIGTWSNVP 81 HSP 14 Score: 33.6001 bits (67), Expect = 3.30824e-15 Query: 111 WWGXVLIWWRXXXH 152 | ||||
WO454_contig21891_v2 | 3.81093e-12 | 83.33% | ||
WO454_contig21891_v2 | ||||
HSP 1 Score: 49.6374 bits (102), Expect = 3.81093e-12 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 2 Score: 34.5166 bits (69), Expect = 3.81093e-12 Query: 95 HHMSTXPHHLRNTH 136 | ||||
WO454_contig4845_v2 | 9.71107e-12 | 80.00% | ||
WO454_contig4845_v2 | ||||
HSP 1 Score: 46.8882 bits (96), Expect = 9.71107e-12 Query: 130 NRTIQVLIPTXTTI*VQVXTTTXXXSSSTI 219 HSP 2 Score: 36.8076 bits (74), Expect = 9.71107e-12 Query: 95 HHMSTXPHHLRNTH 136 | ||||
tags