RO454_contig27215_v2

NameRO454_contig27215_v2
AccessionID3247092
Sequence
GAATATGTTCACGGCAGGCACTGACACGTCATCTAGCACAGTGGAATGGG
CCTTAGCCGAACTCATCCGGCACCCTAAGATCCTGGCCCAAGTCCAACAA
GAGCTTGACTCCGTTGTGGGCCGAGACCGGCTCGTAGGTGAATTAGACCT
AGCCCAACTCACTTACCTCCAGGCTGTGGTCAAGGAAACCTTCCGGCTCC
ACCCTTCAACCCCACTCTCTCTGCCACGCATGGCAGCCGAAAGTTGTGAA
ATCGATGGCTACCACATTCCAAAGGGCTCCACTCTTTTAGTCAATGTTTG
GGCCATATCTCGTGATCCAAAACAATGGACCAACCCATTAGAGTTTAGGC
CCGAACGCTTCCTACCGGGTAGCGAAAAGGCCCATGTTGATATTAAGGGA
AATGAYTTTGAAGYCATACCATTTGGTGCTGGGCGTAGAATATGTGCTGG
GATGAGCTTAGGTTTACGCATGGTTCAACTAYTAACTGCAACCTTAGTTC
ATGCATATGATTGGGACCTGCCTGATGGATTGATGCCTGAGAAACTGAAC
ATGGATGAGGCATATGGGCTGACCTTGCAGCGAGCCGCGCCCTTGATGGT
GCACCCTTGGCCGAGGCTCTCCTCACACGTCTATCGGGCATCCTCTTGAA
AGAATTTTAATATA
Length664
Typecontig
Organism Red Oak

[-] Collapse All

References

Dababase Accession
GFF_source SeqManPro

ESTs in this contig

Type Feature Position
EST ROA_007775_2691_0212 0-183
EST ROA_049331_2771_0456 99-378
EST ROB_079759_1719_2522 268-532
EST ROA_056010_0657_2802 342-589
EST ROA_102904_0366_0832 432-664

GO terms assigned to this feature

Accession Category Term
GO:0009055 molecular_function electron carrier activity
GO:0020037 molecular_function heme binding
GO:0005506 molecular_function iron ion binding
GO:0004497 molecular_function monooxygenase activity

InterProScan Analysis

Analysis Date: 11-19-2009 (Interpro: RO454_contigs_v2)
SEQUENCE: RO454_contig27215_v2_2_ORF1 CRC64: FD813E9729BB6741 LENGTH: 215 aa
InterPro
IPR001128
Family
Cytochrome P450
G3DSA:1.10.630.10 [1-207]T 4.9e-72 G3DSA:1.10.630.10 no description no description
PTHR19383 [1-169]T 4.3e-108 PTHR19383 CYTOCHROME P450 CYTOCHROME P450
PF00067 [1-202]T 6.1e-76 PF00067 p450 p450
SSF48264 [1-205]T 1.2e-77 SSF48264 Cytochrome P450 Cytochrome P450
InterPro
IPR017972
Conserved_site
Cytochrome P450, conserved site
PS00086 [141-150]T NA PS00086 CYTOCHROME_P450 CYTOCHROME_P450
noIPR
unintegrated
unintegrated
PTHR19383:SF171 [1-169]T 4.3e-108 PTHR19383:SF171 FLAVONOID 3-HYDROXYLASE FLAVONOID 3-HYDROXYLASE
SEQUENCE: RO454_contig27215_v2_4_ORF2 CRC64: F20373117A133F87 LENGTH: 71 aa
No hits reported.
SEQUENCE: RO454_contig27215_v2_4_ORF3 CRC64: 878A37217E3E6678 LENGTH: 54 aa
noIPR
unintegrated
unintegrated
seg [5-21]? NA seg seg seg
SEQUENCE: RO454_contig27215_v2_6_ORF2 CRC64: 795168D58FA4C5A0 LENGTH: 87 aa
noIPR
unintegrated
unintegrated
seg [19-30]? NA seg seg seg
SEQUENCE: RO454_contig27215_v2_2_ORF1 CRC64: FD813E9729BB6741 LENGTH: 215 aa
InterPro
IPR001128
Family
Cytochrome P450
GENE3DG3DSA:1.10.630.10no description
 4.9e-72 [1-207]T       
PANTHERPTHR19383CYTOCHROME P450
 4.3e-108 [1-169]T       
PFAMPF00067p450
 6.1e-76 [1-202]T       
SUPERFAMILYSSF48264Cytochrome P450
 1.2e-77 [1-205]T       
Parent no parent
Children IPR002397 IPR002401 IPR002402 IPR002403
Found in no entries
Contains IPR002399 IPR017972 IPR017973
GO terms Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: heme binding (GO:0020037)
InterPro
IPR017972
Conserved_site
Cytochrome P450, conserved site
PROSITEPS00086CYTOCHROME_P450
 NA [141-150]T       
Parent no parent
Children no children
Found in IPR001128 IPR002397 IPR002401 IPR002403 IPR002974 IPR008066 IPR008071 IPR017973 IPR020469
Contains no entries
GO terms none
noIPR
unintegrated
unintegrated
PANTHERPTHR19383:SF171FLAVONOID 3-HYDROXYLASE
 4.3e-108 [1-169]T       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none
SEQUENCE: RO454_contig27215_v2_4_ORF2 CRC64: F20373117A133F87 LENGTH: 71 aa
No hits reported.
SEQUENCE: RO454_contig27215_v2_4_ORF3 CRC64: 878A37217E3E6678 LENGTH: 54 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [5-21]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none
SEQUENCE: RO454_contig27215_v2_6_ORF2 CRC64: 795168D58FA4C5A0 LENGTH: 87 aa
noIPR
unintegrated
unintegrated
SEGseg seg
 NA [19-30]?       
Parent no parent
Children no children
Found in no entries
Contains no entries
GO terms none

Blast Hits to MedicagoProt

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_MedicagoProt_20080227)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
IMGA|AC149471_6.5 E-cla7.6353e-5850.93%
s P450, group I chr01_pseudomolecule_IMGAG_V2 30856059-30858441 E EGN_Mt071002 20080227
HSP 1
Score: 219.55 bits (558), Expect = 7.6353e-58
Identity = 109/214 (50.93%), Postives = 148/214 (69.16%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
MFTAGTDT++ST+EWA+AEL+ +P+ L++VQ EL S + DR + E D+ L YL+AV+KET RLHP P +P MA +SC I Y IPK + +LVNVWAI RDPK W PL F PERF+ + VD KG+ FE IPFG+GRR+C + L R++ L +L++++DW L DGL PE+++M E G+TL++A PL V P P S V A++
Sbjct: 307 MFTAGTDTTTSTLEWAMAELLHNPRTLSKVQMELRSKISSDRKMEEKDIESLPYLKAVIKETLRLHPPLPFLVPHMAMDSCMIGDYFIPKETQILVNVWAIGRDPKVWDAPLLFWPERFM---QPNMVDYKGHHFEYIPFGSGRRMCPALPLASRVLPLALGSLLNSFDWILSDGLKPEEMDMTEGMGITLRKAVPLKVIPVPYKGSPVAAAAA 517

IMGA|AC141114_7.4 E-cla8.73591e-5449.28%
s P450, group I chr07_pseudomolecule_IMGAG_V2 21957365-21955282 H EGN_Mt071002 20080227
HSP 1
Score: 206.068 bits (523), Expect = 8.73591e-54
Identity = 102/207 (49.28%), Postives = 141/207 (68.12%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLS 622
++F AGTDTS+ T+EWALAELI +P ++ +QE++ VVG +R+V E D+ L YLQA+VKET R+HP+ PL + R ++E C I GY IP + L VN+W+I RDP W NPLEFRPERF+ +E ++D++G F IPFG+GRR C G SL L +VQ A ++ ++W + G +NM+E GLTL RA PL+ P PR +
Sbjct: 305 DIFIAGTDTSALTIEWALAELINNPHMMEIARQEINDVVGNNRIVEESDIINLPYLQAIVKETLRIHPTGPL-IVRESSEKCTIQGYEIPAKTQLFVNIWSIGRDPNYWDNPLEFRPERFI--NEVGNLDVRGQHFHLIPFGSGRRACPGTSLALHVVQTNLAAMIQCFEWKVKGG--NGIVNMEEKPGLTLSRAHPLICVPVPRFN 506

IMGA|AC191602_2.3 E-cla1.14095e-5346.12%
s P450, group I chr02_pseudomolecule_IMGAG_V2 16176313-16178589 E EGN_Mt071002 20080227
HSP 1
Score: 205.682 bits (522), Expect = 1.14095e-53
Identity = 95/206 (46.12%), Postives = 144/206 (69.90%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
+M TDTS++++EW ++EL+++P+++ +VQ+EL++VVG R V E DL +L YL V+KE+ R+HP PL +P + E C ++ + IPK S ++VN WAI RDP WT+P +F PERF E ++D+ G+DF+ IPFG+GRR C G+ LGL MV+L+ A +VH +D LP+ ++P L+M EA+G+T+ RA L+ P RL
Sbjct: 272 DMLIGSTDTSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKVEESDLDKLEYLNMVIKESLRIHPVVPLLVPHQSMEDCTVEDFFIPKNSRIIVNGWAIMRDPNSWTDPEKFWPERF----EGNNIDVGGHDFQLIPFGSGRRGCPGLHLGLTMVRLVVAQIVHCFDLKLPNDMLPSDLDMTEAFGITMPRANHLIALPVYRL 473

IMGA|CT027663_58.5 E-cla2.54176e-5346.80%
s P450, group I chr05_pseudomolecule_IMGAG_V2 1144530-1146710 F EGN_Mt071002 20080227
HSP 1
Score: 204.527 bits (519), Expect = 2.54176e-53
Identity = 95/203 (46.80%), Postives = 142/203 (69.95%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEA-YGLTLQRAAPLMVHP 607
++ GTDT++ T+EWA+AEL+ +P ++++V++EL+ +G + E D+ +L YLQA++KET RLHP PL LPR A E E++GY IPKG+ + VNVWAI RDPK W NP F PERFL +DIKG +F+ PFG+GRRIC G+ L +RM+ ++ +L+ ++DW L +G+ PE+++M++A GL L++ L V P
Sbjct: 264 DLLVGGTDTTTYTLEWAMAELLHNPNVMSKVKKELEETIGIGNPIEESDVTRLPYLQAIIKETLRLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVWDNPNLFSPERFL----GTKLDIKGQNFQLTPFGSGRRICPGLPLAMRMLHMMLGSLLISFDWKLENGMKPEEIDMEDAIQGLALRKCESLRVIP 462

IMGA|CT027663_8.5 E-cla1.26146e-5246.80%
s P450, group I chr05_pseudomolecule_IMGAG_V2 1189628-1187807 H EGN_Mt071002 20080227
HSP 1
Score: 202.216 bits (513), Expect = 1.26146e-52
Identity = 95/203 (46.80%), Postives = 142/203 (69.95%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEA-YGLTLQRAAPLMVHP 607
++ GTDT++ T+EWA+AEL+ +P I+++V++EL+ +G + E D+A+L YLQA++KET RLHP PL LPR A E E++GY IPKG+ + VNVWAI RDPK W NP F P+RFL +DIKG +F+ PFG+GRRIC G+ L +RM+ ++ +L+ ++DW L + + PE+++M++A GL L++ L V P
Sbjct: 297 DLLVGGTDTTTYTLEWAMAELLHNPNIMSKVKKELEDTIGIGNPIEESDVARLPYLQAIIKETLRLHPIAPLLLPRKAKEDVEVNGYLIPKGAQIFVNVWAIGRDPKVWDNPNLFSPKRFL----GTKLDIKGQNFQLTPFGSGRRICPGLPLAMRMLHMMLGSLLISFDWKLENDMKPEEIDMEDAIQGLALRKCESLRVIP 495

IMGA|AC157489_17.4 E-cla1.64752e-5245.71%
s P450, group I chr04_pseudomolecule_IMGAG_V2 27259665-27257445 E EGN_Mt071002 20080227
HSP 1
Score: 201.83 bits (512), Expect = 1.64752e-52
Identity = 96/210 (45.71%), Postives = 147/210 (70.00%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+F G+DT+S T+ WAL L+ +P ++ + ++ELD+ +G++R V E D+ +LTYLQA+VKET RL+P PLS PR +E+C + GYH+ KG+ L+ N+W I+ DP W +PLEF+PERFL + VD++G++F +PFG+GRRIC G+SLGL+M+ + A+ +H++D P PE ++M E++GLT +A PL + P LS + Y
Sbjct: 328 LFAGGSDTTSVTLTWALCLLLNNPLVMEKAKEELDAQIGKERCVCESDINKLTYLQAIVKETLRLYPPAPLSGPREFSENCTLGGYHVIKGTRLITNLWRINTDPNIWPDPLEFKPERFL--TTHKDVDVRGSNFVLLPFGSGRRICPGISLGLQMLHFILASFLHSFDILNP---TPELVDMSESFGLTNTKATPLKILIKPHLSINCY 532

IMGA|AC202461_21.3 Arthropod hemocyanin/in3.67029e-5248.06%
ect LSP; E-class P450, group I chr01_pseudomolecule_IMGAG_V2 9543371-9545663 E EGN_Mt071002 20080227
HSP 1
Score: 200.675 bits (509), Expect = 3.67029e-52
Identity = 99/206 (48.06%), Postives = 137/206 (66.50%), Query Frame = 2
Query:   14 AGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHV 631
AG +TSS+T+ WA+AEL+R P+++ + Q E+ + + VGE + +L YL+ VVKET RLHP TPL L R ++CEI+GYHIP S ++VN W I RDPK WT P F PERF+ S +D KGN+FE IPFGAGRRIC G++ GL V+L A L++ +DW LP+G+ E L+M E +G ++R + L + P L S +
Sbjct: 305 AGGETSSTTIVWAMAELVRDPRVMKKAQYEVRKIFNKKGTVGENYINELEYLKLVVKETLRLHPPTPLLL-RECGQACEIEGYHIPAKSKVIVNAWTIGRDPKYWTEPERFHPERFIGSS----IDYKGNNFEYIPFGAGRRICPGITFGLINVELALALLLYHFDWRLPNGMKGEDLDMTEQFGANVKRKSDLYLIPTIPLPSRI 505

IMGA|AC202461_12.3 E-cla3.67029e-5248.08%
s P450, group I chr01_pseudomolecule_IMGAG_V2 9508413-9506382 E EGN_Mt071002 20080227
HSP 1
Score: 200.675 bits (509), Expect = 3.67029e-52
Identity = 100/208 (48.08%), Postives = 137/208 (65.87%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSS 625
N+ AG DTS+ST+ WA++EL+R +++ + Q E+ + V E + +LTYL++VVKET RLHP PL LPR ++CEIDGY IP S ++VN WAI RDPK WT P +F PERF+ S +D KGN+FE IPFGAGRRIC G + GL V+L A +++ +DW LP+G+ E L+M E +G T++R L + P L S
Sbjct: 303 NIVGAGGDTSASTIVWAMSELVRDKRVMKKAQDEVRDIFNMKGNVEENCINELTYLKSVVKETLRLHPPGPLLLPRECGQACEIDGYRIPIKSKVIVNAWAIGRDPKYWTEPEKFYPERFIGSS----IDYKGNNFEYIPFGAGRRICPGSTFGLINVELALALMLYHFDWKLPNGMKGEDLDMTEQFGATVKRKDDLYLIPTAPLPS 506

IMGA|AC140774_3.5 Arthropod hemocyanin/in3.67029e-5248.06%
ect LSP; E-class P450, group I chr01_pseudomolecule_IMGAG_V2 9439015-9441305 E EGN_Mt071002 20080227
HSP 1
Score: 200.675 bits (509), Expect = 3.67029e-52
Identity = 99/206 (48.06%), Postives = 137/206 (66.50%), Query Frame = 2
Query:   14 AGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHV 631
AG +TSS+T+ WA+AEL+R P+++ + Q E+ + + VGE + +L YL+ VVKET RLHP TPL L R ++CEI+GYHIP S ++VN W I RDPK WT P F PERF+ S +D KGN+FE IPFGAGRRIC G++ GL V+L A L++ +DW LP+G+ E L+M E +G ++R + L + P L S +
Sbjct: 305 AGGETSSTTIVWAMAELVRDPRVMKKAQYEVRKIFNKKGTVGENYINELEYLKLVVKETLRLHPPTPLLL-RECGQACEIEGYHIPAKSKVIVNAWTIGRDPKYWTEPERFHPERFIGSS----IDYKGNNFEYIPFGAGRRICPGITFGLINVELALALLLYHFDWRLPNGMKGEDLDMTEQFGANVKRKSDLYLIPTIPLPSRI 505

IMGA|AC137079_2.5 E-cla1.06789e-5145.85%
s P450, group I chr05_pseudomolecule_IMGAG_V2 34636257-34638089 E EGN_Mt071002 20080227
HSP 1
Score: 199.134 bits (505), Expect = 1.06789e-51
Identity = 94/205 (45.85%), Postives = 141/205 (68.78%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
++F AGT+TSS+TV WA++E++++PK++ + Q E+ V R V E +L QL YL++V+KET RLHP+ PL LPR + E C+I+GY IP + ++VN WAI RDP+ W + F+PERF+ + +D KG DFE IPFGAGRR+C G++ L V+L A+L++ +DW LP+ + E+L+M E++G+T R L + P R
Sbjct: 300 DIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIYLKSVIKETMRLHPTVPLLLPRESRERCQINGYEIPAKTRVMVNAWAIGRDPRYWVDAESFKPERFV----NSPIDFKGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKNEELDMTESFGITAGRKHNLCLIPITR 500

Blast Hits to Contigs V2 WO454

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_WO454_contigs_v2)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
WO454_contig20437_v21.32956e-5754.55%
WO454_contig20437_v2
HSP 1
Score: 171.979 bits (369), Expect = 1.32956e-57
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M TAG DT++ +VEW +AELI++P++ + Q+ELD V+G +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NP EFRPERFL
Sbjct: 165 DMITAGMDTTAISVEWGMAELIKNPRVQQKAQEELDRVIGFERVMTEADFSNLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAMWKNPTEFRPERFL 527

HSP 2
Score: 67.0494 bits (140), Expect = 1.32956e-57
Identity = 23/49 (46.94%), Postives = 34/49 (69.39%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGL 532
VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+G+
Sbjct: 9 VDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFVWTPPEGI 155

HSP 3
Score: 53.3031 bits (110), Expect = 8.38528e-17
Identity = 30/63 (47.62%), Postives = 33/63 (52.38%), Query Frame = -2
Query:  175 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTT 363
R SG NS G H GSR AQTLT +P GM *P L+ A G SGV G + SL T
Sbjct: 166 RNLSGRNSVGFFHIAGSRATAQTLT*TFDPLGMS*PPTLTLALAR*GSISGVGGCNLSASLAT 354

HSP 4
Score: 35.433 bits (71), Expect = 8.38528e-17
Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = -2
Query:  385 PKLIPAHILRPAPNGMXSKSFPLIST 462
P P H RPAPNG KS P +ST
Sbjct: 79 PSCAPGHTRRPAPNGSSRKS*PFMST 156

HSP 5
Score: 30.3927 bits (60), Expect = 8.38528e-17
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = -2
Query:   10 WTWARILGCRMSSAKAHSTVLDDVSVPAV 96
W + LG +SSA HST + VS+PAV
Sbjct: 433 WAFCCTLGFFISSAIPHSTEIAVVSIPAV 519

WO454_contig9423_v21.20614e-5648.76%
WO454_contig9423_v2
HSP 1
Score: 160.982 bits (345), Expect = 1.20614e-56
Identity = 59/121 (48.76%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ GT++S+ TVEWA++E+++ P++ + +ELD V+GRDR V E D+ L Y+ A++KET RLHP P+ +PR++ E C I GY I KG+ +LVNVW I RDP W P EF PERF+
Sbjct: 448 DLIAGGTESSAVTVEWAISEILKKPEVFNKATEELDRVIGRDRWVEEKDIVNLPYIDAIIKETMRLHPVAPMLVPRLSREDCNIAGYDILKGTRVLVNVWTIGRDPTLWDKPNEFYPERFI 810

HSP 2
Score: 74.8389 bits (157), Expect = 1.20614e-56
Identity = 25/46 (54.35%), Postives = 36/46 (78.26%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
+D+KG+DFE +PFGAGRR+C G SLGL+++Q + L+H + W LP
Sbjct: 820 IDVKGHDFELLPFGAGRRMCPGYSLGLKVIQSSLSNLLHGFTWSLP 957

WO454_contig5524_v22.26269e-5647.11%
WO454_contig5524_v2
HSP 1
Score: 142.196 bits (304), Expect = 2.26269e-56
Identity = 57/121 (47.11%), Postives = 82/121 (67.77%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG T+S TVEWA+ L+++P+ + + + EL+ V+G+ + ELD+++ YLQA+VKET RLHPS P LPR A EI G+ +PK + +L+NVWA+ RD W N F PERFL
Sbjct: 577 DLFHAGIATTSGTVEWAMTMLLQNPEKMTKARVELEEVLGKAGRIQELDISKFLYLQAIVKETLRLHPSAPFLLPRKAMIDVEICGFIVPKNAQILINVWAMGRDXSIWXNXNLFMPERFL 939

HSP 2
Score: 92.709 bits (196), Expect = 2.26269e-56
Identity = 38/74 (51.35%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+D KG DFE IPFGAGRRIC G+ L RMV L+ A+LV+ W LPD + PE + E +G L R PL P
Sbjct: 949 IDFKGRDFELIPFGAGRRICPGLPLANRMVHLMLASLVYYSAWKLPDEMRPEXMXXGETFGXXLXRXVPLXAIP 1170

HSP 3
Score: 53.3031 bits (110), Expect = 3.77547e-16
Identity = 30/73 (41.10%), Postives = 36/73 (49.32%), Query Frame = -2
Query:  388 GCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIS 606
G +G CK P S M SG+ SG Q+ *T+ A T+ P HIL PAP G+ SKS PL S
Sbjct: 951 GXAXRGTXLCKXXPNVSPMXMXSGLISSGSFQAE**TRDANIKCTILLANGNPGHILLPAPKGISSKSXPLKS 1169

HSP 4
Score: 39.5569 bits (80), Expect = 3.77547e-16
Identity = 23/64 (35.94%), Postives = 29/64 (45.31%), Query Frame = -2
Query:  163 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR* 354
SG+N H S +A T G P IS A+RG +G +G + KVS T A R*
Sbjct: 738 SGINKFXFXHMLXSXPIAHTFISICAFLGTMKPHISTSIIALRGSRNGADGCNLKVSFTIA*R* 929

HSP 5
Score: 23.9778 bits (46), Expect = 3.77547e-16
Identity = 10/15 (66.67%), Postives = 12/15 (80.00%), Query Frame = -2
Query:    7 AHSTVLDDVSVPAVN 51
AHSTV D V++PA N
Sbjct: 582 AHSTVPDVVAIPA*N 626

WO454_contig6232_v24.80742e-5445.92%
WO454_contig6232_v2
HSP 1
Score: 122.034 bits (260), Expect = 4.80742e-54
Identity = 45/98 (45.92%), Postives = 71/98 (72.45%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVN 295
+M + DTS++ +EW +EL+R+P+++ VQ+EL+ VVG +R+V E DLA+L YL VVKE+ RLHP PL +P + E E++GY++PK S +++N
Sbjct: 280 DMISGAYDTSAAAIEWTFSELLRYPRVMKHVQEELERVVGMNRMVEETDLAKLPYLDMVVKESLRLHPVGPLLVPHESMEDIEVNGYYVPKKSRIIIN 573

HSP 2
Score: 98.2075 bits (208), Expect = 4.80742e-54
Identity = 41/91 (45.05%), Postives = 60/91 (65.93%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS*K 652
+++D+KG F+XIPFG+GRR C GM LGL V+ + A L+H + W LP G++ L+M E +GL++ RA L P RL + +Y+A S K
Sbjct: 648 SNIDLKGRXFQXIPFGSGRRGCPGMHLGLTTVKYVLAQLLHCFHWMLPSGMLXNDLDMSEKFGLSMHRAKHLSAMPTYRLLA*IYKACSMK 920

HSP 3
Score: 25.3524 bits (49), Expect = 4.80742e-54
Identity = 8/15 (53.33%), Postives = 11/15 (73.33%), Query Frame = 2
Query:  299 WAISRDPKQWTNPLE 343
WAI RDP W++ +E
Sbjct: 576 WAIGRDPCVWSDNVE 620

WO454_contig3805_v21.12523e-5247.93%
WO454_contig3805_v2
HSP 1
Score: 154.567 bits (331), Expect = 1.12523e-52
Identity = 58/121 (47.93%), Postives = 84/121 (69.42%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
N+ G DT T+ WA + L+ + +L + Q E+D+ VG++R+V E D+ +L YLQA+VKET RL+P+ PLS PR E C I GYH+PKG+ L+ N+W I D +W++PL+F+PERFL
Sbjct: 201 NLIAGGNDTXVVTLTWATSLLLNNRHVLKKAQDEVDNQVGKERIVNESDINKLVYLQAIVKETLRLYPAAPLSAPREFIEDCTIGGYHVPKGTRLIPNLWKIQTDHHKWSDPLKFKPERFL 563

HSP 2
Score: 67.9658 bits (142), Expect = 1.12523e-52
Identity = 26/49 (53.06%), Postives = 33/49 (67.35%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGL 532
VD KG +FE IPFG+GRRIC G S G++MV L A+ +H YD P +
Sbjct: 39 VDFKGQNFEFIPFGSGRRICPGASFGVQMVHLALASFLHMYDISTPSNV 185

HSP 3
Score: 47.8046 bits (98), Expect = 2.60007e-13
Identity = 20/37 (54.05%), Postives = 24/37 (64.86%), Query Frame = -2
Query:  166 PFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR 276
PFG *P + Q S RG ++G G+ RKVSLT AWR
Sbjct: 289 PFGTX*PPMVQSSMNSRGADNGAAGYKRKVSLTMAWR 399

HSP 4
Score: 42.3061 bits (86), Expect = 2.60007e-13
Identity = 22/46 (47.83%), Postives = 25/46 (54.35%), Query Frame = -2
Query:  385 GRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 522
G SY K+A T+ PK P HIL P PNG+ SK PL ST
Sbjct: 49 GVEMSYMCKKLASAXCTI*TPKDAPGHILLPLPNGINSKFCPLKST 186

WO454_contig21461_v21.05292e-4845.16%
WO454_contig21461_v2
HSP 1
Score: 133.031 bits (284), Expect = 1.05292e-48
Identity = 56/124 (45.16%), Postives = 76/124 (61.29%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGS 373
++F G DT + T+ WA+AEL ++P+++ + Q E+ + +G V E D L YL+ +VKETFRLHP L LPR +I+GY I + VN WAI RDPK W NP EF PERF+ S
Sbjct: 172 DIFLXGVDTXAITMIWAMAELAKNPRLMKKAQDEVRNFIGXKGKVTESDTDHLHYLKMIVKETFRLHPPATLLLPRETMSHFKINGYDIYPKMLVQVNAWAIGRDPKYWENPEEFIPERFMDNS 543

HSP 2
Score: 76.2135 bits (160), Expect = 1.05292e-48
Identity = 27/64 (42.19%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTL 577
+D KG +FE + FG+GRR C G + ++L A L++ ++W LPDG+ E +NM+E GL+L
Sbjct: 544 IDYKGQNFELLTFGSGRRSCPGXYMATTTIELALANLLYCFNWKLPDGIKEEDINMEEXXGLSL 735

WO454_contig20681_v23.47582e-4143.08%
WO454_contig20681_v2
HSP 1
Score: 134.864 bits (288), Expect = 3.47582e-41
Identity = 56/130 (43.08%), Postives = 80/130 (61.54%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVD 391
N+ A +T+ +VEW +AEL+ HP+I +++ E+D+V+G V E D +L YLQAVVKET RL + PL +P M ++ G+ IP S +LVN W ++ +P W NP EFRPERFL K +
Sbjct: 969 NINVAAIETTLWSVEWGIAELVNHPEIQKKLRHEIDTVLGPGVQVTEPDTLKLPYLQAVVKETLRLRMAIPLLVPHMNLHDAKLGGFDIPAESKILVNAWWLANNPANWKNPEEFRPERFLEEESKVEAN 1358

HSP 2
Score: 49.1792 bits (101), Expect = 3.47582e-41
Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 2
Query:  374 EKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDG 529
E++ V+ GNDF +PFG GRR C G+ L L ++ + LV ++ P G
Sbjct: 1335 EESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPG 1490

WO454_contig3370_v23.59079e-3949.59%
WO454_contig3370_v2
HSP 1
Score: 157.316 bits (337), Expect = 3.59079e-39
Identity = 60/121 (49.59%), Postives = 87/121 (71.90%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M G+D+S+ T+ W +A L+ + +L + Q ELD V R+R+V E D+++L YLQA+VKET RL+P+ LS PR E+C I GYH+PKG+ L+ N+W I DP+ W++PLEF+PERFL
Sbjct: 26 SMIAGGSDSSTVTLTWTIALLLNNRHVLKKAQDELDVQVXRERIVNESDISKLVYLQAIVKETLRLYPAGRLSGPREFTENCIIGGYHVPKGTRLITNIWKIQTDPRIWSDPLEFKPERFL 388

HSP 2
Score: 52.8449 bits (109), Expect = 7.86588e-12
Identity = 23/40 (57.50%), Postives = 25/40 (62.50%), Query Frame = -2
Query:  157 PFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VS 276
PFG W*P I Q S RG +S G+ R VSLT AWR* S
Sbjct: 114 PFGTW*PPIMQFSVNSRGPDSRPAGYKRNVSLTMAWR*TS 233

HSP 3
Score: 32.2255 bits (64), Expect = 7.86588e-12
Identity = 16/43 (37.21%), Postives = 23/43 (53.49%), Query Frame = -1
Query:  260 NMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVV 388
N+ + ++FG +L*WV P WI P + S A WN+V
Sbjct: 2 NINILVGGEKSFGLEL*WV*PNAWICLDFPYVCD*SSAFWNMV 130

WO454_contig572_v22.66778e-3848.05%
WO454_contig572_v2
HSP 1
Score: 97.7493 bits (207), Expect = 2.66778e-38
Identity = 37/77 (48.05%), Postives = 53/77 (68.83%), Query Frame = 2
Query:  389 DIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
D KG++FE IPFG+GRR C GM LGL + L A L+H + W+LPDG+ P +++M++ +GLT RA L+ P R+
Sbjct: 110 DYKGSNFEFIPFGSGRRSCPGMQLGLYALDLCVAHLLHCFTWELPDGMKPSEMDMNDVFGLTAPRAIRLVAVPTKRV 340

HSP 2
Score: 56.9688 bits (118), Expect = 2.66778e-38
Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 2
Query:  236 AESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
AE E+ GY+IP S +++N WAI RD W + F+P RFL
Sbjct: 356 AEDAEVAGYYIPAKSRVMINAWAIGRDSNSWEDAETFKPSRFL 484

HSP 3
Score: 37.724 bits (76), Expect = 2.66778e-38
Identity = 16/35 (45.71%), Postives = 21/35 (60.00%), Query Frame = 2
Query:  140 ELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAES 244
E D +L YL+ +KET RLHP PL L A ++
Sbjct: 473 ESDFDKLKYLKCCLKETLRLHPPIPLLLHETAEDA 577

WO454_contig14656_v21.4995e-3650.00%
WO454_contig14656_v2
HSP 1
Score: 148.61 bits (318), Expect = 1.4995e-36
Identity = 60/120 (50.00%), Postives = 83/120 (69.17%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+ AGTD ++ T+ WAL+ L+ + L + QQELD VGR+R V E D+ L YLQA++KET RL+P+ LS+P + E C + GYH+P G+ L+VNV + RDP W+NP EF+PERFL
Sbjct: 4 LMLAGTDATTITLTWALSLLLNNFGALRKAQQELDLQVGRERQVEESDMKILVYLQAIIKETMRLYPAASLSVPHESTEDCTLAGYHVPAGTRLIVNVSKLHRDPDVWSNPNEFQPERFL 363

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_TAIR7_pep_20070425)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
AT5G07990.1 3.12966e-9272.56%
TT7 (TRANSPARENT TESTA 7); flavonoid 3'-monooxygenase/ oxygen binding | chr5:2560438-2562860 FORWARD
HSP 1
Score: 334.339 bits (856), Expect = 3.12966e-92
Identity = 156/215 (72.56%), Postives = 185/215 (86.05%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
NMFTAGTDTS+STV+WA+AELIRHP I+ + Q+ELD VVGRDR V E D+AQL YLQAV+KE FRLHP TPLSLP +A+ESCEI+GYHIPKGSTLL N+WAI+RDP QW++PL F+PERFLPG EK+ VD+KG+DFE IPFGAGRRICAG+SLGLR +Q LTATLV +DW+L G+ PEKLNM+E+YGLTLQRA PL+VHP PRL+ +VY S
Sbjct: 298 NMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHPKPRLAPNVYGLGS 512

AT2G45550.1 1.41793e-6052.97%
CYP76C4 (cytochrome P450, family 76, subfamily C, polypeptide 4); oxygen binding | chr2:18780615-18782728 REVERSE
HSP 1
Score: 229.18 bits (583), Expect = 1.41793e-60
Identity = 107/202 (52.97%), Postives = 149/202 (73.76%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+MFTAGTDTSSST+EWA+AEL+R+PK + + Q E+D V+G++ +V E D++ L YLQAVVKETFRLHP+ PL +PR A E+ G+ +PK + +LVNVWAI RDP W NP +F PERF+ G + +D+KG D+E PFG GRRIC G+ L ++ V L+ A+L++++DW LP+G++ E L+MDE +G+TL R L P
Sbjct: 307 DMFTAGTDTSSSTLEWAMAELLRNPKTMVKAQAEMDRVLGQNSVVQESDISGLPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVLVNVWAIGRDPSVWENPSQFEPERFM-GKD---IDVKGRDYELTPFGGGRRICPGLPLAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMDETFGITLHRTNTLYAIP 504

AT2G45560.1 5.38814e-6053.47%
CYP76C1 (cytochrome P450, family 76, subfamily C, polypeptide 1); heme binding / iron ion binding / monooxygenase | chr2:18783465-18785428 REVERSE
HSP 1
Score: 227.254 bits (578), Expect = 5.38814e-60
Identity = 108/202 (53.47%), Postives = 148/202 (73.27%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+MFTAGTDTSSST+EWA+ EL+++PK +A+ Q E+D V+G++ +V E D+++L YLQAVVKETFRLH PL +PR A EI G+ + K + +LVNVWAI RDP W NP +F PERFL G + +D++G D+E PFGAGRRIC GM L ++ V L+ A+L++++DW LP G++ E L+MDE +GLTL + PL P
Sbjct: 307 DMFTAGTDTSSSTLEWAMTELLKNPKTMAKAQAEIDCVIGQNGIVEESDISKLPYLQAVVKETFRLHTPVPLLIPRKAESDAEILGFMVLKDTQVLVNVWAIGRDPSVWDNPSQFEPERFL-GKD---MDVRGRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAVP 504

AT2G40890.1 3.8614e-5849.53%
CYP98A3 (cytochrome P450, family 98, subfamily A, polypeptide 3); p-coumarate 3-hydroxylase | chr2:17065369-17067610 REVERSE
HSP 1
Score: 221.09 bits (562), Expect = 3.8614e-58
Identity = 105/212 (49.53%), Postives = 143/212 (67.45%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
+M TAG DT++ T EWA+AE+I++P++ +VQ+E D VVG DR++ E D ++L YLQ VVKE+FRLHP TPL LP + +I GY IPKGS + VNVWA++RDP W NP EFRPERFL + VD+KG+DF +PFGAGRR+C G LG+ +V + + L+H + W P G PE+++M E GL P+ PRL S +Y+
Sbjct: 295 DMITAGMDTTAITAEWAMAEMIKNPRVQQKVQEEFDRVVGLDRILTEADFSRLPYLQCVVKESFRLHPPTPLMLPHRSNADVKIGGYDIPKGSNVHVNVWAVARDPAVWKNPFEFRPERFL----EEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMMSHLLHHFVWTPPQGTKPEEIDMSENPGLVTYMRTPVQAVATPRLPSDLYK 502

AT2G45570.1 6.58656e-5851.49%
CYP76C2 (cytochrome P450, family 76, subfamily C, polypeptide 2); oxygen binding | chr2:18787009-18788996 REVERSE
HSP 1
Score: 220.32 bits (560), Expect = 6.58656e-58
Identity = 104/202 (51.49%), Postives = 146/202 (72.28%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
++F AGTDT+SSTVEWA+AEL+R+P+ + + Q E+D V+G+ +V E D++ L YLQAVVKETFRLHP+ PL +PR A E+ G+ +PK + + VNVWAI RDP W N F+PERFL G + +D++G D+E PFGAGRRIC G+ L ++ V L+ A+L++++DW LP+G+ E L+MDE +GLTL + PL P
Sbjct: 308 DLFGAGTDTNSSTVEWAMAELLRNPETMVKAQAEIDCVIGQKGVVEESDISALPYLQAVVKETFRLHPAAPLLVPRKAESDVEVLGFMVPKDTQVFVNVWAIGRDPNVWENSSRFKPERFL-GKD---IDLRGRDYELTPFGAGRRICPGLPLAVKTVPLMLASLLYSFDWKLPNGVGSEDLDMDETFGLTLHKTNPLHAVP 505

AT3G61040.1 4.26928e-5750.74%
CYP76C7 (cytochrome P450, family 76, subfamily C, polypeptide 7); oxygen binding | chr3:22605049-22607100 REVERSE
HSP 1
Score: 217.624 bits (553), Expect = 4.26928e-57
Identity = 103/203 (50.74%), Postives = 146/203 (71.92%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMA-AESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
++F AG DTSSS VEWA+AEL+R+PK++ +VQ+E+ V+G V +LD+ +L YLQAVVKE+ RLHP P +PR + ++ +I + IPK + +LVNVWAI RDP W NP +F PERFL +D+KGN FE IPFGAGRRIC GM L R++ L+ A+L++ +DW+ +G++PE ++M+EA+G TL +A PL + P
Sbjct: 295 DLFLAGVDTSSSAVEWAMAELLRNPKMIVKVQEEIRQVIGLKGTVQDLDIVKLPYLQAVVKESLRLHPPAPFLVPRKSESDDVQIFEFLIPKNTQVLVNVWAIGRDPNVWKNPTQFEPERFLGRG----IDVKGNHFELIPFGAGRRICPGMPLAFRIMHLVLASLLYGFDWEYQNGVVPENVDMNEAFGATLHKAEPLCIVP 493

AT1G33730.1 9.51097e-5751.26%
CYP76C5 (cytochrome P450, family 76, subfamily C, polypeptide 5); oxygen binding | chr1:12227259-12228440 FORWARD
HSP 1
Score: 216.468 bits (550), Expect = 9.51097e-57
Identity = 102/199 (51.26%), Postives = 144/199 (72.36%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLM 598
+MF AGTDT+SSTVEWA+ EL+ +PK + +VQ E++ V+ ++ V E +++L YLQAV+KETFRLHP+ P LPR A +I G+H+PK S +LVNVWAI RDP W NP +F PERFL G + +D+KG ++E PFGAGRRIC G+ L L+ V L+ A+L++ ++W LP+G+ E L+M E +GLT+ + PL+
Sbjct: 171 DMFLAGTDTNSSTVEWAMTELLGNPKTMTKVQDEINRVIRQNGDVQESHISKLPYLQAVIKETFRLHPAAPFLLPRKAERDVDILGFHVPKDSHVLVNVWAIGRDPNVWENPTQFEPERFL-GKD---IDVKGTNYELTPFGAGRRICPGLPLALKTVHLMLASLLYTFEWKLPNGVGSEDLDMGETFGLTVHKTNPLL 365

AT1G33720.1 2.11882e-5651.49%
CYP76C6 (cytochrome P450, family 76, subfamily C, polypeptide 6); oxygen binding | chr1:12220937-12223961 REVERSE
HSP 1
Score: 215.312 bits (547), Expect = 2.11882e-56
Identity = 104/202 (51.49%), Postives = 145/202 (71.78%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+MF AGTDT+SSTVEWA+AEL+ +PK + +VQ E++ V+G++ E D+++L YL+AVVKETFRLHP+ P L R A + EI G+ + K S +LVNVWAI RDP W NP F PERFL G E +D+KG D+E PFGAGRRIC G+ L ++ V L+ A+L++ ++W LP+G+ E L+M+E +GLT+ + PL+ P
Sbjct: 307 DMFVAGTDTNSSTVEWAMAELLGNPKTMTKVQDEINHVIGQNGDFQESDISKLPYLKAVVKETFRLHPAAPFLLQRKAETNVEILGFTVLKDSQVLVNVWAIGRDPLVWENPTHFEPERFL-GKE---IDVKGTDYELTPFGAGRRICPGLPLAMKTVHLMLASLLYTFEWKLPNGVGSEDLDMEETFGLTVHKTNPLLAVP 504

AT4G12320.1 2.19264e-5345.19%
CYP706A6 (cytochrome P450, family 706, subfamily A, polypeptide 6); oxygen binding | chr4:7314936-7316428 REVERSE
HSP 1
Score: 205.297 bits (521), Expect = 2.19264e-53
Identity = 94/208 (45.19%), Postives = 145/208 (69.71%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSS 625
++ GTDTS++T+E+A+AELIR P+++ + QQELD VVG+D ++ E + +L ++ A++KET RL+P+ PL +P +E+ + GY IPK + + +NVW+I RDP W P EFRPERFL +K D G D+ +PFG+GRRICAG++L RM+ ATL+H++DW +P+G + L++ E +G+ L+ +PL+ P PRLS+
Sbjct: 240 DLVVGGTDTSTNTIEFAMAELIRKPELMKRAQQELDEVVGKDNIIEESHITRLPFISAIMKETLRLYPTIPLLVPHRPSETALVGGYTIPKNTKIFINVWSIQRDPNVWEYPTEFRPERFL---DKKSCDFTGTDYSYLPFGSGRRICAGIALAERMILYTLATLLHSFDWKIPEGHI---LDLKEKFGIVLKLKSPLVALPVPRLSN 441

AT4G12310.1 6.3796e-5345.67%
CYP706A5 (cytochrome P450, family 706, subfamily A, polypeptide 5); oxygen binding | chr4:7310593-7312517 REVERSE
HSP 1
Score: 203.756 bits (517), Expect = 6.3796e-53
Identity = 95/208 (45.67%), Postives = 142/208 (68.27%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSS 625
+M GT++S++T+E+ +AELI +P+++ + QQELD VVG+D +V E + L Y+ AV+KET RL+P+ PL +P +E+ + GY IPK + + +NVW+I RDP W P EFRPERFL +K D G D+ +PFG+GRRICAG++L RM+ ATL+H++DW +PDG L+++E +G+ L+ PL+ P PRLS+
Sbjct: 314 DMVVGGTESSTNTIEFVMAELISNPELMRRAQQELDEVVGKDNIVEESHITSLPYILAVLKETLRLYPTIPLLVPHRPSETALVGGYTIPKNTKIFINVWSIQRDPNVWEYPTEFRPERFL---DKKSCDFTGTDYSYLPFGSGRRICAGIALAERMILYTLATLLHSFDWTIPDG---HVLDLEEKFGIVLKLKTPLVALPIPRLSN 515

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_PopulusProt_JamboreeModels1_1)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
estExt_fgenesh4_pg.C_LG_XIII03373.66587e-10788.68%
jgi|Poptr1_1|823742|estExt_fgenesh4_pg.C_LG_XIII0337
HSP 1
Score: 384.03 bits (985), Expect = 3.66587e-107
Identity = 188/212 (88.68%), Postives = 198/212 (93.40%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
NMFTAGTDTSSSTVEWA+AELIRHP ILAQV+QELDSVVGRDRLV ELDLAQLTYLQAVVKETFRLHPSTPLSLPR+AAESCEI GYHIPKGST+LVNVWAI+RDP WT PLEFRPERFLPG +KA VD+KGNDFE IPFGAGRRICAGMSLGLRMVQLLTATL+HA+DWDL DGL+PEKLNMDEAYGLTLQRA PLMVHP PRLS VYR
Sbjct: 307 NMFTAGTDTSSSTVEWAIAELIRHPDILAQVKQELDSVVGRDRLVTELDLAQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEIGGYHIPKGSTVLVNVWAIARDPDVWTKPLEFRPERFLPGGDKADVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDWDLADGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVYR 518

fgenesh4_pm.C_LG_IX0004511.77861e-6957.94%
jgi|Poptr1_1|804404|fgenesh4_pm.C_LG_IX000451
HSP 1
Score: 258.84 bits (660), Expect = 1.77861e-69
Identity = 124/214 (57.94%), Postives = 163/214 (76.17%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEK-AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRA 640
N+FTAGTDTSSS +EW+LAE++++P+IL Q Q E+D V+GR+R + E D+ +L YLQA+ KETFR HPSTPL+LPR+A ++CE++GY+IPKG+ L VN+WAI RDP W NPL+F PERF SEK A ++ +GNDFE IPFGAGRRICAG +G+ +VQ + TLVH++DW LP + +LNMDE +GL LQ+A PL PRL + Y A
Sbjct: 297 NLFTAGTDTSSSIIEWSLAEMLKNPRILKQAQDEMDQVIGRNRRLEESDIPKLPYLQAICKETFRKHPSTPLNLPRIADQACEVNGYYIPKGTRLSVNIWAIGRDPDVWDNPLDFTPERFF--SEKYAKINPQGNDFELIPFGAGRRICAGTRMGIVLVQYILGTLVHSFDWKLPKDV---ELNMDEVFGLALQKAVPLSAMVTPRLEPNAYLA 505

eugene3.000118274.10037e-6655.40%
jgi|Poptr1_1|549386|eugene3.00011827
HSP 1
Score: 247.669 bits (631), Expect = 4.10037e-66
Identity = 118/213 (55.40%), Postives = 158/213 (74.18%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRA 640
++FTAGTDTSSS +EWALAE++++ IL + Q+E+D V+GR+R + E D+ +L YLQAV KETFR HPSTPL+LPR+A ++CE++GY+IPKG+ L VN+WAI RDP W NP F PERF + A ++ +GNDFE IPFGAGRRICAG +G+ +V+ + TLVH++DW LP+ + LNMDE +GL LQ+A PL PRL + Y A
Sbjct: 300 DLFTAGTDTSSSVIEWALAEMLKNQSILKRAQEEMDQVIGRNRRLVESDIPKLPYLQAVCKETFRKHPSTPLNLPRIADQACEVNGYYIPKGARLSVNIWAIGRDPDVWDNPEVFTPERFFT-EKYAKINPRGNDFELIPFGAGRRICAGARMGIVLVEYILGTLVHSFDWKLPEDV---DLNMDEVFGLALQKAVPLSAMVSPRLEPNAYLA 508

eugene3.001602473.36211e-6051.42%
jgi|Poptr1_1|576112|eugene3.00160247
HSP 1
Score: 228.024 bits (580), Expect = 3.36211e-60
Identity = 109/212 (51.42%), Postives = 144/212 (67.92%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
+M TAG DT++ TVEWA+AELI++P++ + Q ELD VVG +R++ E D L YLQAVVKE+ RLHP TPL LP A + +I GY IPKGS + VNVWA++RDP W NPLEFRPERF + VD++G+DF +PFGAGRR+C G LG+ +V + L+H + W PDG+ PE+++M E GL PL PRL SH+Y+
Sbjct: 296 DMITAGMDTTAITVEWAMAELIKNPRVQQKAQDELDRVVGFERVMTEADFPNLPYLQAVVKESLRLHPPTPLMLPHRANTTVKIGGYDIPKGSVVHVNVWAVARDPALWKNPLEFRPERFF----EEDVDMRGHDFRLLPFGAGRRVCPGAQLGINLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATPRLPSHLYK 503

eugene3.145400017.48999e-6050.47%
jgi|Poptr1_1|582895|eugene3.14540001
HSP 1
Score: 226.868 bits (577), Expect = 7.48999e-60
Identity = 107/212 (50.47%), Postives = 145/212 (68.40%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
+M TAG DT++ +VEWA+AEL+++P++ + Q ELD VVG +R++ E D L YLQAVVKE+ RLHP TPL LP A+ + +I GY IPKGS + VNVWA++RDP W NPLEFRPERF + VD++G+DF +PFGAGRR+C G LG+ +V + L+H + W PDG+ PE+++M E GL PL PRL SH+Y+
Sbjct: 296 DMITAGMDTTAISVEWAMAELLKNPRVQQKAQDELDRVVGFERVMTEADFPNLPYLQAVVKESLRLHPPTPLMLPHRASTTVKIGGYDIPKGSVVHVNVWAVARDPALWKNPLEFRPERFF----EEDVDMRGHDFRLLPFGAGRRVCPGAQLGINLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATPRLPSHLYK 503

gw1.I.9276.12.17925e-5951.49%
jgi|Poptr1_1|180676|gw1.I.9276.1
HSP 1
Score: 225.328 bits (573), Expect = 2.17925e-59
Identity = 104/202 (51.49%), Postives = 147/202 (72.77%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
++F AGTDT+SST+EWA+AEL+ +P+ L+ + EL+ +G+ L+ E D+ +L YLQAV+KETFRLHP+ PL LPR A E+ EI GY IPKG+ L VN WAI RDP W +P F PERFL GS+ +D +G +FE IPFGAGRRIC G+ L +RM+ ++ +L+H++DW L +G+ PE ++M++ +G+TL +A L P
Sbjct: 268 DLFAAGTDTTSSTLEWAMAELLHNPRTLSIARTELEQTIGKGSLIEESDIVRLPYLQAVIKETFRLHPAVPLLLPRKAGENVEISGYTIPKGAQLFVNAWAIGRDPSLWEDPESFVPERFL-GSD---IDARGRNFELIPFGAGRRICPGLPLAMRMLHMMLGSLIHSFDWKLENGVTPESMDMEDKFGITLGKARSLRAVP 465

estExt_fgenesh4_pm.C_LG_VI00968.28115e-5950.00%
jgi|Poptr1_1|831788|estExt_fgenesh4_pm.C_LG_VI0096
HSP 1
Score: 223.402 bits (568), Expect = 8.28115e-59
Identity = 106/212 (50.00%), Postives = 144/212 (67.92%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
+M TAG DT++ +VEWA+AELI++P++ + Q+ELDSVVG +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W PLEFRPERFL + VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+G+ PE+++M E GL PL PRL SH+Y+
Sbjct: 295 DMITAGMDTTAISVEWAMAELIKNPRVQQKAQEELDSVVGFERVMTEADFSGLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPATWKKPLEFRPERFL----EEDVDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFCWTPPEGMKPEEIDMSENPGLVTYMTTPLQAVATPRLPSHLYK 502

eugene3.000706158.28115e-5950.24%
jgi|Poptr1_1|562677|eugene3.00070615
HSP 1
Score: 223.402 bits (568), Expect = 8.28115e-59
Identity = 104/207 (50.24%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLS 622
+M DTSS+ ++WA +ELI++P+++ +VQ+EL+ VVG+ R+V E DL L YL VVKETFRLHP PL +P A E C ++G+HIPK S +++NVWAI RDPK WT+ F PERF+ GS+ +D++G +F+ IPFGAGRR C GM LGL +V+L+ A LVH +DW+LP+G++P +++M E +GL + R+ L+ P RL+
Sbjct: 68 DMLAGSMDTSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMVEESDLESLEYLDMVVKETFRLHPVGPLLIPHEAMEDCIVNGFHIPKKSHVIINVWAIGRDPKAWTDAENFYPERFV-GSD---IDVRGRNFQLIPFGAGRRSCPGMQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVICRSKHLVAIPTYRLN 270

eugene3.361600021.08155e-5849.53%
jgi|Poptr1_1|591136|eugene3.36160002
HSP 1
Score: 223.016 bits (567), Expect = 1.08155e-58
Identity = 105/212 (49.53%), Postives = 144/212 (67.92%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
+M +AG DT++ +VEWA+AEL+++P++ + Q ELD VVG +R++ E D L YLQAVVKE+ RLHP TPL LP A + +I GY IP+GS + VNVWA++RDP W NPLEFRPERF + VD++G+DF +PFGAGRR+C G LG+ +V + L+H + W PDG+ PE+++M E GL PL PRL SH+Y+
Sbjct: 296 DMISAGMDTTAISVEWAMAELLKNPRVQQKAQDELDRVVGFERVMTEADFPNLPYLQAVVKESLRLHPPTPLMLPHRANTTVKIGGYDIPRGSVVHVNVWAVARDPALWKNPLEFRPERFF----EEDVDMRGHDFRLLPFGAGRRVCPGAQLGINLVTSIIGHLLHHFHWTTPDGVKPEEIDMSERPGLVTYMMTPLQAVATPRLPSHLYK 503

eugene3.025600121.08155e-5851.90%
jgi|Poptr1_1|588655|eugene3.02560012
HSP 1
Score: 223.016 bits (567), Expect = 1.08155e-58
Identity = 109/210 (51.90%), Postives = 148/210 (70.48%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWP--RLSSH 628
MFTAGTDT++ST+EWA+AEL+R+PK+L VQ EL S +G ++ + + D+ L YL+AV++ET RLHP P +P MA C++ GY+IPK +T+LVNVWAI RD K W +PL F+PERFL E VD KG FE IPFG+GRR+C M L R++ L +L+ ++DW LP+GL PE ++M E G+TL+++ PL V P P R S H
Sbjct: 307 MFTAGTDTTTSTLEWAMAELLRNPKVLKTVQSELRSTIGPNKKLEDKDIENLPYLKAVIRETLRLHPPLPFLVPHMAMNPCKMLGYYIPKETTILVNVWAIGRDSKTWDDPLVFKPERFL---ESNMVDYKGRHFEFIPFGSGRRMCPAMPLASRVLPLALGSLLLSFDWILPEGLKPEDMDMTEKMGITLRKSVPLKVIPTPYKRSSDH 513

Blast Hits to Contig V2 Oall

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_Oall_contigs_v2)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
Oall_contig27724_v27.92887e-151100.00%
Oall_contig27724_v2
HSP 1
Score: 529.382 bits (1149), Expect = 7.92887e-151
Identity = 221/221 (100.00%), Postives = 221/221 (100.00%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS*KNFNI 664
NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS*KNFNI
Sbjct: 1 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS*KNFNI 663

HSP 2
Score: 525.716 bits (1141), Expect = 1.00055e-149
Identity = 219/221 (99.10%), Postives = 219/221 (99.10%), Query Frame = -1
Query:    2 YIKILSRGCPIDV*GEPRPRVHHQGRGSLQGQPICLIHVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFKXISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI 664
YIKILSRGCPIDV*GEPRPRVHHQGRGSLQGQPICLIHVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFK ISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTY PVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI
Sbjct: 1 YIKILSRGCPIDV*GEPRPRVHHQGRGSLQGQPICLIHVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFKVISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYXPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI 663

HSP 3
Score: 523.425 bits (1136), Expect = 4.92447e-149
Identity = 218/220 (99.09%), Postives = 218/220 (99.09%), Query Frame = 3
Query:    3 ICSRQALTRHLAQWNGP*PNSSGTLRSWPKSNKSLTPLWAETGS*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQRAPLF*SMFGPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREMXLKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TWMRHMG*PCSEPRP*WCTLGRGSPHTSIGHPLERILI 662
ICSRQALTRHLAQWNGP*PNSSGTLRSWPKSNKSLTPLWAETG *VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQRAPLF*SMFGPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREM LKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TWMRHMG*PCSEPRP*WCTLGRGSPHTSIGHPLERILI
Sbjct: 3 ICSRQALTRHLAQWNGP*PNSSGTLRSWPKSNKSLTPLWAETGX*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQRAPLF*SMFGPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREMTLKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TWMRHMG*PCSEPRP*WCTLGRGSPHTSIGHPLERILI 662

HSP 4
Score: 491.35 bits (1066), Expect = 2.22729e-139
Identity = 209/221 (94.57%), Postives = 209/221 (94.57%), Query Frame = 1
Query:    1 EYVHGRH*HVI*HSGMGLSRTHPAP*DPGPSPTRA*LRCGXXXXXXXXXXXXTHLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSKGLHSFSQCLGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK*X*SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG*GIWADLAASRALDGAPLAEALLTRLSGILLKEF*Y 663
EYVHGRH*HVI*HSGMGLSRTHPAP*DPGPSPTRA*LRCG X THLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSKGLHSFSQCLGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK* *SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG*GIWADLAASRALDGAPLAEALLTRLSGILLKEF*Y
Sbjct: 2 EYVHGRH*HVI*HSGMGLSRTHPAP*DPGPSPTRA*LRCGPRPAXR*IRPSPTHLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSKGLHSFSQCLGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK*L*SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG*GIWADLAASRALDGAPLAEALLTRLSGILLKEF*Y 664

HSP 5
Score: 415.288 bits (900), Expect = 1.5609e-135
Identity = 173/186 (93.01%), Postives = 173/186 (93.01%), Query Frame = -3
Query:  105 Y*NSFKRMPDRRVRRASAKGXXXXXXXXXXXAHMPHPCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQXHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWPKH*LKEWSPLECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLRAGLGPQRSQ 662
Y*NSFKRMPDRRVRRASAKG AHMPHPCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQ HFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWPKH*LKEWSPLECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHL AGLGPQRSQ
Sbjct: 3 Y*NSFKRMPDRRVRRASAKGAPSRARLAARSAHMPHPCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQSHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWPKH*LKEWSPLECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLXAGLGPQRSQ 560

HSP 6
Score: 84.9195 bits (179), Expect = 1.5609e-135
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = -2
Query:    1 CWTWARILGCRMSSAKAHSTVLDDVSVPAVNIF 99
CWTWARILGCRMSSAKAHSTVLDDVSVPAVNIF
Sbjct: 566 CWTWARILGCRMSSAKAHSTVLDDVSVPAVNIF 664

HSP 7
Score: 398.334 bits (863), Expect = 5.36348e-120
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = -2
Query:  151 ILKFFQEDAR*TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 663
ILKFFQEDAR*TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA
Sbjct: 2 ILKFFQEDAR*TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 514

HSP 8
Score: 50.0956 bits (103), Expect = 5.36348e-120
Identity = 19/19 (100.00%), Postives = 19/19 (100.00%), Query Frame = -3
Query:    3 RLRPIPLC*MTCQCLP*TY 59
RLRPIPLC*MTCQCLP*TY
Sbjct: 606 RLRPIPLC*MTCQCLP*TY 662

Oall_contig22927_v29.34307e-6648.76%
Oall_contig22927_v2
HSP 1
Score: 161.44 bits (346), Expect = 9.34307e-66
Identity = 59/121 (48.76%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ GT++S+ TVEWA++E+++ P++ + +ELD V+GRDR V E D+ L Y+ A++KET RLHP P+ +PR++ E C I GY I KG+ +LVNVW I RDP W P EF PERF+
Sbjct: 517 DLIAGGTESSAVTVEWAISEILKKPEVFKKATEELDRVIGRDRWVEEKDIVNLPYIDAIIKETMRLHPVAPMLVPRLSREDCNIAGYDILKGTRVLVNVWTIGRDPTLWDKPNEFYPERFI 879

HSP 2
Score: 105.997 bits (225), Expect = 9.34307e-66
Identity = 39/83 (46.99%), Postives = 57/83 (68.67%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG+D+E +PFGAGRR+C G SLGL+++Q + L+H + W LP+ + E NM+E +GL+ + PL V PRL HVY
Sbjct: 259 IDVKGHDYELLPFGAGRRMCPGYSLGLKVIQSSLSNLLHGFTWSLPENMKIEDFNMEEIFGLSTPKKFPLEVVVKPRLPKHVY 507

Oall_contig20720_v21.75801e-6554.55%
Oall_contig20720_v2
HSP 1
Score: 172.896 bits (371), Expect = 1.75801e-65
Identity = 66/121 (54.55%), Postives = 89/121 (73.55%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M TAG DT++ +VEW +AELI++P++ + Q+ELD V+G +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP+ W NP EFRPERFL
Sbjct: 909 DMITAGMDTTAISVEWGMAELIKNPRVQQKAQEELDRVIGFERVMTEADFSNLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPEMWKNPTEFRPERFL 1271

HSP 2
Score: 93.6255 bits (198), Expect = 1.75801e-65
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+GL E++++ E GL PL PRL SH+Y+
Sbjct: 1281 VDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFVWTPPEGLKAEEIDLSENPGLVTYMRTPLQAIASPRLPSHLYK 1532

HSP 3
Score: 53.3031 bits (110), Expect = 7.01799e-15
Identity = 30/63 (47.62%), Postives = 33/63 (52.38%), Query Frame = -2
Query:  175 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTT 363
R SG NS G H GSR AQTLT +P GM *P L+ A G SGV G + SL T
Sbjct: 1082 RNLSGRNSVGFFHISGSRATAQTLT*TFDPLGMS*PPTLTLALAR*GSISGVGGCNLSASLAT 1270

HSP 4
Score: 31.7673 bits (63), Expect = 7.01799e-15
Identity = 13/26 (50.00%), Postives = 14/26 (53.85%), Query Frame = -2
Query:  385 PKLIPAHILRPAPNGMXSKSFPLIST 462
P P RPAPNG KS P +ST
Sbjct: 1280 PSCAPGQTRRPAPNGSSXKS*PFMST 1357

HSP 5
Score: 28.5598 bits (56), Expect = 7.01799e-15
Identity = 14/29 (48.28%), Postives = 17/29 (58.62%), Query Frame = -2
Query:   10 WTWARILGCRMSSAKAHSTVLDDVSVPAV 96
W + LG +SSA HST + VS PAV
Sbjct: 917 WAFCCTLGFFISSAIPHSTEIAVVSXPAV 1003

Oall_contig22280_v23.54437e-5946.49%
Oall_contig22280_v2
HSP 1
Score: 143.57 bits (307), Expect = 3.54437e-59
Identity = 53/114 (46.49%), Postives = 82/114 (71.93%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLE 343
+M + DTS++ +EW +EL+R+P+++ VQ+EL+ VVG +R+V E DLA+L YL VVKE+ RLHP PL +P + E E++GY++PK S +++N WAI RDP W++ +E
Sbjct: 461 DMISGAYDTSAAAIEWTFSELLRYPRVMKHVQEELERVVGMNRMVEETDLAKLPYLXMVVKESLRLHPVGPLLVPHESMEDIEVNGYYVPKKSRIIINFWAIGRDPCVWSDNVE 802

HSP 2
Score: 101.873 bits (216), Expect = 3.54437e-59
Identity = 42/91 (46.15%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS*K 652
+++D+KG DF+XIPFG+GRR C GM LGL V+ + A L+H + W LP G++ L+M E +GL++ RA L P RL + +Y+A S K
Sbjct: 161 SNIDLKGRDFQXIPFGSGRRGCPGMHLGLTTVKYVLAQLLHCFHWXLPSGMLSNDLDMSEKFGLSMXRAKHLSAMPTYRLLA*IYKACSMK 433

Oall_contig4154_v21.2042e-5751.69%
Oall_contig4154_v2
HSP 1
Score: 112.87 bits (240), Expect = 1.2042e-57
Identity = 46/89 (51.69%), Postives = 61/89 (68.54%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHI 268
+M A DTS++ ++W L ELIRHP+I+ +VQ+EL++VVG +R+V E DL L YL VVKET RLHP PL P + E C I+ Y I
Sbjct: 518 DMLXASMDTSATAIDWXLTELIRHPRIMKKVQKELENVVGLERMVDESDLDSLEYLDMVVKETMRLHPVAPLLXPHESLEDCTINXYXI 784

HSP 2
Score: 89.5016 bits (189), Expect = 1.2042e-57
Identity = 36/71 (50.70%), Postives = 48/71 (67.61%), Query Frame = 2
Query:  407 FEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
FE IPFG GRR C G LG +V+L+ A LVH +DW+LP+ ++P +L+M E +GLT RA L+ P RL
Sbjct: 174 FELIPFGXGRRSCPGXQLGXXVVRLVLAQLVHCFDWELPNDMLPTELDMTEEFGLTTPRAKHLLAIPTYRL 386

HSP 3
Score: 56.5106 bits (117), Expect = 1.2042e-57
Identity = 20/34 (58.82%), Postives = 24/34 (70.59%), Query Frame = 2
Query:  263 HIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+IP S L +NVWAI RDP WT P +F PERF+
Sbjct: 418 YIPXKSRLXINVWAIGRDPSVWTEPXKFNPERFV 519

Oall_contig13579_v22.68239e-5645.08%
Oall_contig13579_v2
HSP 1
Score: 147.694 bits (316), Expect = 2.68239e-56
Identity = 55/122 (45.08%), Postives = 80/122 (65.57%), Query Frame = 2
Query:    8 FTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGS 373
F AGTDT+ + +EW + ELIRHP+++ +VQ E + G + + E DL ++ YL+A++KE RLHP PL PR + + +IDGY I G+ +++N W I +DP W P EF+PERFL S
Sbjct: 342 FXAGTDTTYTVLEWTMTELIRHPEMMKKVQNEXREIAGNKKNITEDDLDKMHYLKAIIKEXLRLHPPIPLLTPRKSXQDAKIDGYDIAAGTQVIINAWTIGKDPTLWDEPEEFQPERFLXSS 707

HSP 2
Score: 88.127 bits (186), Expect = 2.68239e-56
Identity = 34/76 (44.74%), Postives = 49/76 (64.47%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWP 613
+D KG+DF+ IPFGAGRR C G+S + ++L+ A L ++W LPDG + + L+M E+ GL + R PLM P
Sbjct: 114 IDFKGHDFQLIPFGAGRRGCPGISFAITTIELVLANLXRNFEWTLPDGAIGKDLDMTESTGLAIHRKFPLMAIATP 341

HSP 3
Score: 40.9315 bits (83), Expect = 5.10998e-13
Identity = 28/75 (37.33%), Postives = 32/75 (42.67%), Query Frame = -2
Query:  388 GQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIS 612
G I+G P S M I PSG S + A S + K IP H L PAPNG+ KS PL S
Sbjct: 115 GVAMAIRGNFL*MAKPVDSVMSKSFPIAPSGNVHSKLRXRFAKTSSIVVMAKEIPGHPLLPAPNGINWKSCPLKS 339

HSP 4
Score: 35.8912 bits (72), Expect = 5.10998e-13
Identity = 24/64 (37.50%), Postives = 31/64 (48.44%), Query Frame = -2
Query:  163 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR* 354
SG NS+G H GS + L P + *PSI RG SG+ G R+ SL A++*
Sbjct: 361 SG*NSSGSSHNVGSFPIVHALIMT*VPAAIS*PSIFAS*XDFRGVNSGIGG*RRRXSLIIAFK* 552

HSP 5
Score: 30.3927 bits (60), Expect = 5.10998e-13
Identity = 15/29 (51.72%), Postives = 17/29 (58.62%), Query Frame = -2
Query:    7 TWARILGCRMSSAKAHSTVLDDVSVPAVN 93
T+ I GC MSS HS + VSVPA N
Sbjct: 622 TFFIISGCLMSSVIVHSKTVYVVSVPAXN 708

Oall_contig39277_v21.62061e-5447.93%
Oall_contig39277_v2
HSP 1
Score: 151.36 bits (324), Expect = 1.62061e-54
Identity = 58/121 (47.93%), Postives = 81/121 (66.94%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
N+ G DT T+ WA + L+ + +L + Q E D VG++R+V E D+ +L YLQA+VKET RL+P PLS PR E C I GYH+PKG+ L+ N+W I D +W++PL+F+PERFL
Sbjct: 335 NLIAGGNDTIVVTLTWATSLLLNNRHVLKKAQDEXDXQVGKERIVNESDINKLVYLQAIVKETLRLYPXAPLSXPREFXEDCTIGGYHVPKGTRLIPNLWKIQTDHHKWSDPLKFKPERFL 697

HSP 2
Score: 67.9658 bits (142), Expect = 1.62061e-54
Identity = 26/49 (53.06%), Postives = 33/49 (67.35%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGL 532
VD KG +FE IPFG+GRRIC G S G++MV L A+ +H YD P +
Sbjct: 173 VDFKGQNFEFIPFGSGRRICPGASFGVQMVHLALASFLHMYDISTPSNV 319

HSP 3
Score: 29.0181 bits (57), Expect = 1.62061e-54
Identity = 13/26 (50.00%), Postives = 18/26 (69.23%), Query Frame = 2
Query:  542 KLNMDEAYGLTLQRAAPLMVHPWPRL 619
K++M E++GLT +A PL V PRL
Sbjct: 95 KVDMTESFGLTNLKATPLEVLITPRL 172

HSP 4
Score: 52.3867 bits (108), Expect = 2.58426e-14
Identity = 21/37 (56.76%), Postives = 24/37 (64.86%), Query Frame = -2
Query:  166 PFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR 276
PFG W*P + Q S RG + G G+ RKVSLT AWR
Sbjct: 423 PFGTW*PPMVQSSXNSRGXDXGAXGYKRKVSLTMAWR 533

HSP 5
Score: 42.3061 bits (86), Expect = 2.58426e-14
Identity = 22/46 (47.83%), Postives = 25/46 (54.35%), Query Frame = -2
Query:  385 GRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 522
G SY K+A T+ PK P HIL P PNG+ SK PL ST
Sbjct: 183 GVEMSYMCKKLASAXCTI*TPKDAPGHILLPLPNGINSKFCPLKST 320

Oall_contig27920_v25.66297e-5447.93%
Oall_contig27920_v2
HSP 1
Score: 149.069 bits (319), Expect = 5.66297e-54
Identity = 58/121 (47.93%), Postives = 84/121 (69.42%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
N+ A +DTS+ T+ WAL+ L+ +P+ L + Q+ELD+ +GR R V E D+ L YLQA++KET RL+P+ PL + + E C + GYH+P G+ L+VN+ I +DP W +P EFRPERFL
Sbjct: 968 NLILAASDTSTITLTWALSLLLNNPETLTKAQEELDTHIGRGRQVKESDMKNLVYLQAILKETMRLYPAAPLLVQHESMEDCTLVGYHVPAGTRLIVNLPKIHQDPNVWVDPSEFRPERFL 1330

HSP 2
Score: 66.1329 bits (138), Expect = 5.66297e-54
Identity = 24/46 (52.17%), Postives = 35/46 (76.09%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
VD++G +FE IPFG+GRR+C G+S L++ QL ATL+HA++ P
Sbjct: 1346 VDVRGQNFELIPFGSGRRMCPGISFALQVTQLTLATLLHAFEISSP 1483

HSP 3
Score: 31.3091 bits (62), Expect = 5.66297e-54
Identity = 14/32 (43.75%), Postives = 20/32 (62.50%), Query Frame = 2
Query:  539 EKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
E ++M E G+T +A PL V+ PRL + VY
Sbjct: 1490 ELVDMTEKGGITNPKATPLEVYLTPRLHAQVY 1585

HSP 4
Score: 50.0956 bits (103), Expect = 8.92864e-14
Identity = 29/66 (43.94%), Postives = 32/66 (48.48%), Query Frame = -2
Query:  166 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR 363
R SG NS G H FGS + LT P G W*P+ Q S SG G+ R VSL AWR
Sbjct: 1132 RNLSGRNSLGSTHTFGS*WIFGRLTISRVPAGTW*PTKVQSSIDSCCTRSGAAGYKRIVSLRIAWR 1329

HSP 5
Score: 42.7643 bits (87), Expect = 8.92864e-14
Identity = 23/46 (50.00%), Postives = 25/46 (54.35%), Query Frame = -2
Query:  385 GRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 522
G S A KVA S K IP HIL P PNG+ SK +PL ST
Sbjct: 1345 GLEISKACNKVASVSCVTCKANEIPGHILLPLPNGINSKFWPLTST 1482

Oall_contig5716_v22.74097e-5349.59%
Oall_contig5716_v2
HSP 1
Score: 151.818 bits (325), Expect = 2.74097e-53
Identity = 60/121 (49.59%), Postives = 80/121 (66.12%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
NM G DT+ T+ W L+ L+ + L + Q+ELD VG+ RLV E D+ L YLQA++KE R++P PLS PR E C I GYH+ KG+ L+VN+W I DP W++PLEF+PERFL
Sbjct: 430 NMIAGGNDTTMVTLTWTLSLLLNNRHALKKAQEELDIKVGKGRLVNEADINNLFYLQAIIKEALRIYPPGPLSGPREFHEDCTIGGYHVTKGTRLVVNLWKIQTDPSVWSDPLEFKPERFL 792

HSP 2
Score: 67.5076 bits (141), Expect = 2.74097e-53
Identity = 24/46 (52.17%), Postives = 35/46 (76.09%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
VD++G +FE IPFG+GRR C G+S GL+M+ L A+L+HA++ P
Sbjct: 277 VDVRGQNFELIPFGSGRRACPGISFGLQMLHLTLASLIHAFEISTP 414

HSP 3
Score: 24.8942 bits (48), Expect = 2.74097e-53
Identity = 11/30 (36.67%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  545 LNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
++M ++GLT ++ PL V PRL S ++
Sbjct: 175 VDMTASFGLTNIKSTPLXVVVKPRLPSTLF 264

HSP 4
Score: 51.4703 bits (106), Expect = 1.77012e-11
Identity = 31/67 (46.27%), Postives = 34/67 (50.75%), Query Frame = -2
Query:  163 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR* 363
R SGLNSNG H GS + LT R PF W*P + Q S G ESG G+ SL A R*
Sbjct: 431 RNLSGLNSNGSDHTLGSVWIFHKLTTRRVPFVTW*PPMVQSSWNSLGPESGPGGYILSASLIMA*R* 631

HSP 5
Score: 33.6001 bits (67), Expect = 1.77012e-11
Identity = 15/27 (55.56%), Postives = 16/27 (59.26%), Query Frame = -2
Query:  385 KPKLIPAHILRPAPNGMXSKSFPLIST 465
+PK IP L P P GM SK PL ST
Sbjct: 335 RPKDIPGQALLPLPKGMSSKF*PLTST 415

Oall_contig33625_v22.74956e-5345.45%
Oall_contig33625_v2
HSP 1
Score: 134.406 bits (287), Expect = 2.74956e-53
Identity = 55/121 (45.45%), Postives = 77/121 (63.64%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG T+S TVEWA+A L+ +P+ + + EL+ V+G+ E D+++ YL A+VKET RLHPS P LPR A + EI G +PK + +L+NVWA+ D W N F PERFL
Sbjct: 1124 DLFLAGIXTTSXTVEWAMAXLLXNPEKMTKAXXELEEVLGKXGXXQEXDISKFXYLXAIVKETLRLHPSAPFLLPRKAKTNXEICGXIVPKNAQILINVWAMGXDXSIWQNXNLFMPERFL 1486

HSP 2
Score: 91.3344 bits (193), Expect = 2.74956e-53
Identity = 38/74 (51.35%), Postives = 45/74 (60.81%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+D KG DFE IPFGAGRRIC G+ L RMV L+ A+LV W LPD + PE + E +G L R PL P
Sbjct: 1496 IDFKGXDFELIPFGAGRRICPGLPLANRMVHLMLASLVXYXAWKLPDEMRPEXMXXGETFGXXLXRXVPLXAIP 1717

HSP 3
Score: 54.6777 bits (113), Expect = 6.18886e-18
Identity = 30/73 (41.10%), Postives = 36/73 (49.32%), Query Frame = -2
Query:  388 GCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIS 606
G +G CK P S M SG+ SG Q+ *T+ A T+ P HIL PAP G+ SKS PL S
Sbjct: 1498 GXAXRGTXLCKXXPNVSPMXMXSGLISSGSFQAX**TRXANIKCTILLANGNPGHILLPAPKGISSKSXPLKS 1716

HSP 4
Score: 44.5971 bits (91), Expect = 6.18886e-18
Identity = 24/64 (37.50%), Postives = 29/64 (45.31%), Query Frame = -2
Query:  163 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR* 354
SG+N H S +A T FG P IS A+RG G +G + KVS T A R*
Sbjct: 1285 SGINKFXFCHMLXSXPIAHTFISICAFFGTXXPHISXFVLALRGSRKGADGCNXKVSFTIAXR* 1476

HSP 5
Score: 24.8942 bits (48), Expect = 6.18886e-18
Identity = 11/19 (57.89%), Postives = 13/19 (68.42%), Query Frame = -2
Query:    7 SSAKAHSTVLDDVSVPAVN 63
+ A AHSTV D V +PA N
Sbjct: 1129 NXAIAHSTVXDVVXIPARN 1185

Blast Hits to C. Parasitica Protein

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_CparasiticaFilteredProteinModelsAAseqs)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
estExt_fgenesh1_kg.C_405124.36861e-2234.10%
Crypa1|102669|estExt_fgenesh1_kg.C_40512
HSP 1
Score: 100.138 bits (248), Expect = 4.36861e-22
Identity = 59/173 (34.10%), Postives = 95/173 (54.91%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERF---LPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYD 511
++ AG+DT++ST+ + ++ P + + Q+ELD V G DRL D L +++ VKE+ R P+ L +P E GY IPKG+ ++ NVWAI DPK++ NP F P R+ + +A + + + FGAGRRIC GM + R + L + ++ A++
Sbjct: 285 SLLEAGSDTTASTLIAFVQAMVVFPDVQKRAQEELDRVCG-DRLPTMEDEPSLQFIRGCVKESLRWMPTAILGVPHAVITDDEYMGYKIPKGAGVVWNVWAIHTDPKRYPNPRAFDPSRYADDFQTASEAATNPDSSKRDQFVFGAGRRICQGMHIAERSLFLGISRMLWAFN 456

e_gw1.8.225.14.83006e-2132.38%
Crypa1|49443|e_gw1.8.225.1
HSP 1
Score: 96.6709 bits (239), Expect = 4.83006e-21
Identity = 68/210 (32.38%), Postives = 99/210 (47.14%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPL-SLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGS---------------EKAHVDIKG----NDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGL 571
++F AG+DT++ST+ A L+ H + L +ELD VVG R D A L Y++A KE R P L P + E +GY+IP G+T+L N WAI+ + + NP F P RFL + EK V++ G + FG GRRIC G +L + + A L+ AYD G + + E + +
Sbjct: 314 SLFGAGSDTTASTLCSAFLALVTHQETLQAAHEELDRVVGGGRSPTFEDEAALPYIRAFCKEVLRWRPVAVLGGTPHASTEDDVYEGYYIPAGTTVLGNSWAINLNEAYYPNPHHFNPLRFLDENIAARAKGATIAGGVQEKQDVEVGGRAHPSKSGHSSFGWGRRICPGANLAANSLFIALAKLLWAYDIGPVPGTKYDTFDYTEGFNI 523

fgenesh1_pg.C_scaffold_170000431.07602e-2034.67%
Crypa1|76129|fgenesh1_pg.C_scaffold_17000043
HSP 1
Score: 95.5153 bits (236), Expect = 1.07602e-20
Identity = 69/199 (34.67%), Postives = 98/199 (49.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPL-SLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFE--XIPFGAGRRICAGMSLGLRMVQLLTATLV---HAYDWDLPDGLMPEKLNMDEAYGLTLQ 580
N+F AG+DTSSST+ + P+ L +ELD VVG DR D L YL+A VKE R + P + G+ IPKG+ + NVWAI + +++ +P F PER+LPG H D + E + FG GRR+C+G +L + + A L+ H PDG + E D GL ++
Sbjct: 283 NLFGAGSDTSSSTLITFVLACCAFPEALVPAWEELDRVVGPDRSPHFDDEPNLPYLRAFVKEVLRWRSVAIIGGQPHSPTQDDVYKGWLIPKGTWIQGNVWAIHHNEREFPDPDRFNPERYLPG----HPDSRPFPGERGYMTFGWGRRVCSGQALAEQGTWVTIARLLWGFHIQKKKRPDGSLVEVDIFDYTNGLNMR 477

estExt_Genewise1.C_506033.13075e-2033.73%
Crypa1|82051|estExt_Genewise1.C_50603
HSP 1
Score: 93.9745 bits (232), Expect = 3.13075e-20
Identity = 57/169 (33.73%), Postives = 87/169 (51.48%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYD 511
+F AG +++ TV A+ L + P + +VQ+E+D+VVG RL D L YL A + E R+ P PL +P + + +G IP GS + N A++RDP + +P +F P+R+ G GN FG GRR C G L L V + AT++ ++
Sbjct: 243 VFIAGGNSTWGTVLSAILFLTKFPDVQRRVQEEIDTVVGTGRLPTFQDRPTLKYLDAFLTECMRVLPLNPLVIPHCSLKDDVYEGMFIPAGSVVFANAKAMTRDPNTYQDPEKFDPDRYAKGEPSP----PGN------FGFGRRKCPGNHLALATVYIYVATMMSVFE 401

e_gw1.2.370.16.97459e-2032.42%
Crypa1|37814|e_gw1.2.370.1
HSP 1
Score: 92.8189 bits (229), Expect = 6.97459e-20
Identity = 59/182 (32.42%), Postives = 95/182 (52.20%), Query Frame = 2
Query:   11 TAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGEL---DLAQLTYLQAVVKETFRLHPSTPLSLPRMAAE-SCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLE-FRPERFLPGSEKAHVDIKGN-------DFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDL 520
TAG+DT++ST+ L L+ +P++LA+++ E+ +L + Q+ YL AVVKE RLH + L L R+ E E+ G+ +P G+ + VN W R+ + W E FRPER+L +A D+ GN + +PFG G R C G + + + L L+ + ++L
Sbjct: 325 TAGSDTTASTLSGLLYHLLVNPRVLARLEDEIMGFATSGKLSERPTFDETRQMPYLDAVVKEALRLHSAVGLPLWRVVPEGGVEVAGHFLPAGTNVGVNAWTAHRNEEVWGRDAEVFRPERWL--EAQAEADVGGNKARLQRMEAYYLPFGLGSRTCIGRHISILEISKLVPRLLRDFAFEL 504

e_gw1.17.45.16.97459e-2029.91%
Crypa1|53312|e_gw1.17.45.1
HSP 1
Score: 92.8189 bits (229), Expect = 6.97459e-20
Identity = 64/214 (29.91%), Postives = 110/214 (51.40%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDF---EXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDW----DLPDGL--MPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
++ A +T+ +T+ + ++ P++ Q E+D V G DR+ D L Y++ +KE+ R P+T L +P A E GY IPK +T++ NVWA+ DPK++ +P F P R+ ++ + + FG GRR+C M+L + + L+ + L+ A+D+ D GL +P+K N+ +GL + AP + PR
Sbjct: 299 SLLQAAMETTLATITGFVQAMVIFPEVAKTAQAEIDRVCG-DRMPRIEDWNDLKYIRGCIKESLRWMPTTILGVPHSADEEELYAGYRIPKKTTIIYNVWALHNDPKRYPDPRRFDPGRWANDDSTSYESATNEEVGKRDHFGFGFGRRMCLAMNLVDQNLFLVMSRLLWAFDFNRAIDDKTGLEIVPDKENLQ--FGLFVM-PAPFPANIAPR 508

fgenesh1_pg.C_scaffold_30012686.97459e-2033.33%
Crypa1|70202|fgenesh1_pg.C_scaffold_3001268
HSP 1
Score: 92.8189 bits (229), Expect = 6.97459e-20
Identity = 59/177 (33.33%), Postives = 88/177 (49.72%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGR--------DRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAY 508
+M G +T +STV+W++ L +HP+I + QE+ + G D L D + Y+ A+ KE R PL+LPR E +G IPKG+T+ +N A + D + W +P FRPER+L EK D FG G R+CAG L R + L+ L+ ++
Sbjct: 311 SMLGGGFETVASTVQWSVGWLAQHPEIQERAFQEIRAFQGLKEGDEESVDPLCDAADDQKCPYMNAMAKEALRYFTVIPLNLPRETTRDVEYEGLFIPKGTTVYMNATACNHDEELWEDPHVFRPERWL---EKP-------DAPVFTFGLGYRMCAGHLLATRELYLIFMRLLASF 477

fgenesh1_pm.C_scaffold_80003161.55378e-1930.95%
Crypa1|64529|fgenesh1_pm.C_scaffold_8000316
HSP 1
Score: 91.6633 bits (226), Expect = 1.55378e-19
Identity = 65/210 (30.95%), Postives = 103/210 (49.05%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCE-IDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXI-PFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDL-PDG---LMPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
+ AG++T+++ + A L HP+ LA++ +E+ S + + QLTY+ A + E FR++P P LPR+ A I G +P G+ + V WA + W P E+ PER++ G + + + E + PF G R C G +L ++ + A LV A+D L P+G L +K+ L R PL VH PR
Sbjct: 324 LIVAGSETTATLLSGATYLLASHPEALAKLTREVRSAFTSEDQITVASAGQLTYMLACLDEAFRMYPPVPTGLPRIVAPGGRMICGEFMPGGTHVGVWQWAANHYSANWAKPFEYHPERWIDGQ---NAEFAADQREAMQPFSYGPRNCIGRNLAYAEMRTIIARLVFAFDLKLAPEGENWLRGQKV-------FNLWRKPPLWVHLVPR 523

estExt_fgenesh1_pg.C_115782.65034e-1927.45%
Crypa1|105659|estExt_fgenesh1_pg.C_11578
HSP 1
Score: 90.8929 bits (224), Expect = 2.65034e-19
Identity = 56/204 (27.45%), Postives = 102/204 (50.00%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLP---GSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+ AG++T+++ + + L+++P+ LA++ E+ S + A+ YL V++E R+ P + LPR + IDG +IP+G T+ +++ ++R PK W +P F PER+L G +K PF G R C G++L ++++ A L+ AYD +L + + +GL + L +HP
Sbjct: 301 LIVAGSETTATALSAIMFWLLKNPECLAKLTHEIRSTFSAPEEITGDAAARCQYLHGVIEEGLRISPPVAIGLPR-DSPGATIDGEYIPEGITVSGDIYTLARHPKYWKDPESFIPERWLGEGLGDDKRAFQ---------PFSTGPRACLGINLAYLEMRVMLAKLIFAYDLELESKEIEDWNRSCRIFGLWKKPPLMLKLHP 494

fgenesh1_pm.C_scaffold_40006884.5208e-1930.24%
Crypa1|62502|fgenesh1_pm.C_scaffold_4000688
HSP 1
Score: 90.1225 bits (222), Expect = 4.5208e-19
Identity = 62/205 (30.24%), Postives = 111/205 (54.15%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEID-GYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
+ AG++T+++ + A L HP +LA++ E+ S + + L + +L Y+ AV+ ET RL P P S PR A E ++ G ++P+ + + + +A+SR PK +T P F PER+L + A+ + + PF G R C G +L ++L+ A ++ +D L + + + ++++E Y L ++ PL VH PR
Sbjct: 306 LIIAGSETTATALSGATYFLGSHPDVLARLATEVRSSFSSEDEITLLSVQKLKYMLAVLDETLRLFPPVPTSFPRRAHEGGDVFCGTYLPENTVIDIWQFAMSRSPKNFTLPDSFIPERWLGDARFANDKREASQ----PFSHGPRNCVGKNLAYAEMRLIMARIIWNFDIVLAEPNV-DWIDINETYSLWEKK--PLYVHLKPR 503

Blast Hits to Contigs V2 CCall

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_CCall_contigs_v2)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
CCall_contig4844_v22.65662e-12696.34%
CCall_contig4844_v2
HSP 1
Score: 448.279 bits (972), Expect = 2.65662e-126
Identity = 184/191 (96.34%), Postives = 189/191 (98.95%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLT 574
NMFTAGTDTSSSTVEWA+AELIRHPK+LAQVQQELDSVVGRDRLVGELDLAQL YLQAVVKETFRLHPSTPLSLPRMAAESCEI+GYHIPKGSTLLVNVWAI+RDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFE IPFGAGRRICAGMSLGLRMVQLLTATLVHA+DWDLPDGLMPEKLNMDEAYGLT
Sbjct: 2 NMFTAGTDTSSSTVEWAIAELIRHPKVLAQVQQELDSVVGRDRLVGELDLAQLXYLQAVVKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIARDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEAIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWDLPDGLMPEKLNMDEAYGLT 574

HSP 2
Score: 404.749 bits (877), Expect = 3.37371e-113
Identity = 173/191 (90.58%), Postives = 176/191 (92.15%), Query Frame = 3
Query:    3 ICSRQALTRHLAQWNGP*PNSSGTLRSWPKSNKSLTPLWAETGS*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQRAPLF*SMFGPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREMXLKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TWMRHMG*P 575
ICSRQALT HLAQWNGP*PNSSGT RSWPKSNKSLTPLWAE GS*VN T*PNSL SRLWSRK SGSTLQP SLCHAW+PKV KSMATTFQRAPLF*SMFGP VIQNNGPTH*SLG NASYRVAKRPMLI REM LK YHLVLGVE+VLG*A*VYAWFNY*L P*FMH+IGTCLMD*CLRN*TWMRHMG*P
Sbjct: 1 ICSRQALTHHLAQWNGP*PNSSGTPRSWPKSNKSLTPLWAEIGS*VNWT*PNSLISRLWSRKHSGSTLQPRSLCHAWRPKVAKSMATTFQRAPLF*SMFGP*HVIQNNGPTH*SLGRNASYRVAKRPMLISREMILKPYHLVLGVEFVLG*A*VYAWFNY*LLP*FMHLIGTCLMD*CLRN*TWMRHMG*P 573

HSP 3
Score: 402.916 bits (873), Expect = 1.19509e-112
Identity = 173/191 (90.58%), Postives = 176/191 (92.15%), Query Frame = -1
Query:    2 GQPICLIHVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFKXISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI 574
GQPICLIHVQFLRHQSIRQVPI CMN*G S**LNHA*T*AHPST STPSTKWY FK ISL+INMGLFATR*EAF PKL*WVGPLFWIT YGPNID*KSGALWNVVAIDF TFG HAWQRE G*RVEPE FLDHSLE+SELG*V FTYEP+SAHNGVKLLLDLGQDL VPDEFG GPFHCAR* VSACREHI
Sbjct: 2 GQPICLIHVQFLRHQSIRQVPIKCMN*GSS**LNHA*T*AHPSTNSTPSTKWYGFKIISLDINMGLFATR*EAFRPKL*WVGPLFWITCYGPNID*KSGALWNVVAIDFATFGRHAWQRERG*RVEPECFLDHSLEISELG*VQFTYEPISAHNGVKLLLDLGQDLGVPDEFGYGPFHCAR*CVSACREHI 574

HSP 4
Score: 332.81 bits (720), Expect = 3.63534e-109
Identity = 136/154 (88.31%), Postives = 137/154 (88.96%), Query Frame = -3
Query:  105 HMPHPCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQXHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWPKH*LKEWSPLECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLRAGLGPQRSQ 566
HMPHPCSVSQASIHQAGPN MHELR QL VEPCVNLSSSQH FYAQHQMV LQ HFP*YQHGPFRYPVGSV A*TLMGWSIVLDH +WPKH*LKEWSPLECGSH F NFR PCVAER GLKGGAG FP*PQPG K VGLG IHLRA LGPQRSQ
Sbjct: 10 HMPHPCSVSQASIHQAGPNQMHELR*QLIVEPCVNLSSSQHKFYAQHQMVWLQNHFP*YQHGPFRYPVGSVPA*TLMGWSIVLDHVLWPKH*LKEWSPLECGSH*FRNFRPPCVAERAGLKGGAGMFP*PQPGDKXVGLGPIHLRADLGPQRSQ 471

HSP 5
Score: 79.8792 bits (168), Expect = 3.63534e-109
Identity = 31/33 (93.94%), Postives = 31/33 (93.94%), Query Frame = -2
Query:    1 CWTWARILGCRMSSAKAHSTVLDDVSVPAVNIF 99
CWTWAR LGCRMSSA AHSTVLDDVSVPAVNIF
Sbjct: 477 CWTWARTLGCRMSSAMAHSTVLDDVSVPAVNIF 575

HSP 6
Score: 387.795 bits (840), Expect = 4.28238e-108
Identity = 160/191 (83.77%), Postives = 165/191 (86.39%), Query Frame = 1
Query:    1 EYVHGRH*HVI*HSGMGLSRTHPAP*DPGPSPTRA*LRCGXXXXXXXXXXXXTHLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSKGLHSFSQCLGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK*X*SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG*GIWAD 573
EYVHGRH*H+I*HSGMG SRTHPAP PGPSPTRA*LRCG T L PGCGQGN+PAPPFNP LSATHG RKL N+WLPHSKGLHSFSQCLGH +*SKTMDQPIRV*A TLPTG*RKGPC*Y GK* *SHTIWCWA*N+CWDELRFTHGST NC LSSCI*LGPA*WIDA*ETEHG*GIWAD
Sbjct: 3 EYVHGRH*HII*HSGMGHSRTHPAPQGPGPSPTRA*LRCGPRSARR*IGPSPTXLSPGCGQGNIPAPPFNPALSATHGGRKLRNQWLPHSKGLHSFSQCLGHST*SKTMDQPIRV*AGTLPTG*RKGPC*YQGK*F*SHTIWCWA*NLCWDELRFTHGSTINCYLSSCI*LGPA*WIDA*ETEHG*GIWAD 575

HSP 7
Score: 308.067 bits (666), Expect = 6.7732e-91
Identity = 133/141 (94.33%), Postives = 133/141 (94.33%), Query Frame = -2
Query:  151 VSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 573
VSPYASSMFSFSGINPSGRSQS A*TKVAV S*TMRKPKLIPA ILRPAPNGM SKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSR MAQTLTKRVEPFGMW*P ISQLSAAMRGRESGVEGWSR VSLTTAWR* SWA
Sbjct: 3 VSPYASSMFSFSGINPSGRSQSNA*TKVAVNS*TMRKPKLIPAQILRPAPNGMASKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRAMAQTLTKRVEPFGMW*PLISQLSAAMRGRESGVEGWSRNVSLTTAWR*XSWA 425

HSP 8
Score: 43.6807 bits (89), Expect = 6.7732e-91
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = -3
Query:    3 RLRPIPLC*MTCQCLP*TY 59
RL PIPLC*M CQCLP*TY
Sbjct: 517 RLWPIPLC*MMCQCLP*TY 573

CCall_contig44188_v24.13121e-6856.41%
CCall_contig44188_v2
HSP 1
Score: 169.688 bits (364), Expect = 4.13121e-68
Identity = 66/117 (56.41%), Postives = 85/117 (72.65%), Query Frame = 2
Query:   14 AGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
A DTS++ ++W L ELIRHP+I+ +VQ+EL++VVG +R+V E DL L YL VVKET RLHP PL +P + E C I+ YHIP+ S LL+NVWAI RDP WT P +F PERF+
Sbjct: 260 ASMDTSATAIDWMLTELIRHPRIMKKVQKELENVVGLERMVDESDLDSLEYLDMVVKETMRLHPVAPLLIPHESLEDCTINDYHIPRKSRLLINVWAIGRDPSVWTEPDKFNPERFI 610

HSP 2
Score: 105.997 bits (225), Expect = 4.13121e-68
Identity = 40/80 (50.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
+++D++G+D E IPFG+GRR C GM LGL +V+L+ A LVH++DW+LP+ ++P +L+M E +GLT RA L+ P RL
Sbjct: 17 SNIDLRGHDLELIPFGSGRRSCPGMQLGLTVVRLVLAQLVHSFDWELPNDMLPTELDMTEEFGLTTPRAKHLLAIPTYRL 256

HSP 3
Score: 48.721 bits (100), Expect = 4.47613e-20
Identity = 28/62 (45.16%), Postives = 33/62 (53.23%), Query Frame = -2
Query:  388 VSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIS 573
V P +S M + G G SQS *T A S T +P IP +L P PNG+ SKS PL S
Sbjct: 63 VRPNSSVMSNSVGNMSLGSSQSKL*TSCANTSRTTVRPNCIPGQLLLPDPNGISSKSCPLRS 248

HSP 4
Score: 45.9718 bits (94), Expect = 4.47613e-20
Identity = 26/60 (43.33%), Postives = 30/60 (50.00%), Query Frame = -2
Query:  175 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTT 354
SGLN +G V GS +A T K ++ GMW* I Q S G G G S VS TT
Sbjct: 270 SGLNLSGSVQTLGSLPIAHTFIKSLDLRGMW*SLIVQSSNDS*GINKGATGCSLMVSFTT 449

HSP 5
Score: 37.2658 bits (75), Expect = 4.47613e-20
Identity = 21/58 (36.21%), Postives = 31/58 (53.45%), Query Frame = -1
Query:   23 PEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RV 196
P GF + ++V + V F Y P+ AH+ +LLL+ R+PD F P +C * V
Sbjct: 428 PHGFFYNHVQVLQAIQVRFIYHPL*AHHIFQLLLNFLHYTRMPD*FREHPINCCC*SV 601

CCall_contig14075_v21.99494e-6751.24%
CCall_contig14075_v2
HSP 1
Score: 166.481 bits (357), Expect = 1.99494e-67
Identity = 62/121 (51.24%), Postives = 89/121 (73.55%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+S+ +EW +AELI +P++L++ ++EL+ ++G+ V E D+++L YLQA+VKETFRLHP PL LPR A EI G+ +PKG+ +LVN WAI RD W NP F+PERF+
Sbjct: 439 DLFIAGNDTTSAALEWTMAELIHNPEVLSKAKEELNQIIGKGNPVEESDISRLPYLQAIVKETFRLHPPVPLLLPRKAEADVEIQGFTVPKGAQVLVNAWAIGRDSSIWENPNSFKPERFM 801

HSP 2
Score: 106.914 bits (227), Expect = 1.99494e-67
Identity = 38/76 (50.00%), Postives = 55/76 (72.37%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+ +D+KG +FE IPFGAGRRIC G+ L +RM+ L+ +L+H +DW L DG PE ++M++ +GL+LQ A PL P
Sbjct: 805 SEIDVKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLIHTFDWRLEDGFKPEDMSMEDKFGLSLQLAQPLRAIP 1032

HSP 3
Score: 55.1359 bits (114), Expect = 4.98793e-20
Identity = 28/61 (45.90%), Postives = 33/61 (54.10%), Query Frame = -2
Query:  172 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTA 354
SGLN G H S +A T PFG P IS ++A+RG SG G +RKVSLT A
Sbjct: 609 SGLNEFGFSHMLESLPIAHAFTSTCAPFGTVKP*ISTSASALRGSNSGTGGCNRKVSLTIA 791

HSP 4
Score: 34.5166 bits (69), Expect = 4.98793e-20
Identity = 14/21 (66.67%), Postives = 15/21 (71.43%), Query Frame = -2
Query:  388 PAHILRPAPNGMXSKSFPLIS 450
P HIL PAPNG+ SK PL S
Sbjct: 813 PGHILLPAPNGISSKFRPLTS 875

HSP 5
Score: 30.3927 bits (60), Expect = 4.98793e-20
Identity = 15/33 (45.45%), Postives = 17/33 (51.52%), Query Frame = -2
Query:  508 GCTIKGAARCKVSPYASSMFSFSGINPSGRSQS 606
G +G A CK P SSM SG+ PS QS
Sbjct: 933 GIARRG*ANCKDKPNLSSMDISSGLKPSSSLQS 1031

HSP 6
Score: 28.5598 bits (56), Expect = 4.98793e-20
Identity = 13/26 (50.00%), Postives = 16/26 (61.54%), Query Frame = -2
Query:    7 RILGCRMSSAKAHSTVLDDVSVPAVN 84
R G +SSA HS D VS+PA+N
Sbjct: 444 RTSGL*ISSAIVHSNAADVVSLPAIN 521

CCall_contig14353_v29.64328e-6749.59%
CCall_contig14353_v2
HSP 1
Score: 160.982 bits (345), Expect = 9.64328e-67
Identity = 60/121 (49.59%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ GT++S+ TVEWA++E+++ P+I + +ELD V+GRDR V E D+ L Y+ A++KET RLHP P+ +PR++ E C I GY I KG+ +LVNVW I RDP W P EF PERF+
Sbjct: 1085 DLIAGGTESSAVTVEWAISEILKKPEIFKKATEELDRVIGRDRWVEEKDIVNLPYIDAIIKETMRLHPVAPMLVPRLSREDCNIAGYDILKGTRVLVNVWTIGRDPTIWDKPNEFYPERFV 1447

HSP 2
Score: 110.121 bits (234), Expect = 9.64328e-67
Identity = 41/83 (49.40%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG+DFE +PFGAGRR+C G SLGL+++Q + L+H + W LP+ + E LNM+E +GL+ + PL V PRL HVY
Sbjct: 1457 IDVKGHDFELLPFGAGRRMCPGYSLGLKVIQSSLSNLLHGFTWSLPENMKTEDLNMEEIFGLSTPKKFPLEVVVKPRLPKHVY 1705

HSP 3
Score: 41.3897 bits (84), Expect = 3.71314e-14
Identity = 22/66 (33.33%), Postives = 31/66 (46.97%), Query Frame = -1
Query:  164 EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEV 361
E+F K W+ P WI+ GP I G NV+A + F W RV+P FL++ + V
Sbjct: 1247 ESFRIKFIWLVPYCWISSNGPYIYKHPGTFENVIASNVAIFAR*TRY*HWCHRVQPHCFLNNCINV 1444

HSP 4
Score: 40.4733 bits (82), Expect = 3.71314e-14
Identity = 16/26 (61.54%), Postives = 19/26 (73.08%), Query Frame = -2
Query:  388 KPKLIPAHILRPAPNGMXSKSFPLIS 465
+P+L P HIL PAP G SKS+PL S
Sbjct: 1459 RPRL*PGHILLPAPKGSSSKSWPLTS 1536

HSP 5
Score: 23.9778 bits (46), Expect = 3.71314e-14
Identity = 17/39 (43.59%), Postives = 18/39 (46.15%), Query Frame = -2
Query:  517 *TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGR 633
*TC SLG T G SP SSMF S SG+
Sbjct: 1588 *TCFGSLGFTTTSSGNFLGVESPNISSMFKSSVFMFSGK 1704

HSP 6
Score: 22.1449 bits (42), Expect = 3.71314e-14
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = -2
Query:   16 RILGCRMSSAKAHSTVLDDVSVP 84
+I G S AHSTV ++SVP
Sbjct: 1099 KISGFFSISEIAHSTVTAELSVP 1167

CCall_contig44497_v21.21058e-6549.59%
CCall_contig44497_v2
HSP 1
Score: 160.524 bits (344), Expect = 1.21058e-65
Identity = 60/121 (49.59%), Postives = 87/121 (71.90%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+S+ +EW +AELI +P++L++ ++EL+ ++G+ E D+++L YLQA+VKETFRLHP PL LPR A EI G+ + KG+ +LVN WAI RD W NP F+PERF+
Sbjct: 254 DLFIAGNDTTSAALEWTMAELIHNPEVLSKAKEELNQIIGKGNPXEESDISRLPYLQAIVKETFRLHPPVPLLLPRKAEADVEIQGFTVXKGAQVLVNAWAIGRDSSIWENPNSFKPERFM 616

HSP 2
Score: 106.914 bits (227), Expect = 1.21058e-65
Identity = 38/76 (50.00%), Postives = 55/76 (72.37%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+ +D+KG +FE IPFGAGRRIC G+ L +RM+ L+ +L+H +DW L DG PE ++M++ +GL+LQ A PL P
Sbjct: 620 SEIDVKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLIHTFDWRLEDGFKPEDMSMEDKFGLSLQLAQPLRAIP 847

HSP 3
Score: 51.9285 bits (107), Expect = 4.19794e-19
Identity = 27/61 (44.26%), Postives = 32/61 (52.46%), Query Frame = -2
Query:  172 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTA 354
SGLN G H S +A T PF P IS ++A+RG SG G +RKVSLT A
Sbjct: 424 SGLNEFGFSHMLESLPIAHAFTSTCAPFXTVKP*ISTSASALRGSNSGTGGCNRKVSLTIA 606

HSP 4
Score: 34.5166 bits (69), Expect = 4.19794e-19
Identity = 14/21 (66.67%), Postives = 15/21 (71.43%), Query Frame = -2
Query:  388 PAHILRPAPNGMXSKSFPLIS 450
P HIL PAPNG+ SK PL S
Sbjct: 628 PGHILLPAPNGISSKFRPLTS 690

HSP 5
Score: 30.3927 bits (60), Expect = 4.19794e-19
Identity = 15/33 (45.45%), Postives = 17/33 (51.52%), Query Frame = -2
Query:  508 GCTIKGAARCKVSPYASSMFSFSGINPSGRSQS 606
G +G A CK P SSM SG+ PS QS
Sbjct: 748 GIARRG*ANCKDKPNLSSMDISSGLKPSSSLQS 846

HSP 6
Score: 28.5598 bits (56), Expect = 4.19794e-19
Identity = 13/26 (50.00%), Postives = 16/26 (61.54%), Query Frame = -2
Query:    7 RILGCRMSSAKAHSTVLDDVSVPAVN 84
R G +SSA HS D VS+PA+N
Sbjct: 259 RTSGL*ISSAIVHSNAADVVSLPAIN 336

CCall_contig32435_v21.0992e-6454.55%
CCall_contig32435_v2
HSP 1
Score: 171.521 bits (368), Expect = 1.0992e-64
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M TAG DT++ +VEW +AELI++P++ + Q+ELD V+G +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NP EFRPERFL
Sbjct: 906 DMITAGMDTTAISVEWGMAELIKNPRVQQKAQEELDRVIGFERVMTEADFSNLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAXWKNPAEFRPERFL 1268

HSP 2
Score: 92.709 bits (196), Expect = 1.0992e-64
Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+G+ E++++ E GL PL PRL SH+Y+
Sbjct: 1278 VDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFVWTPPEGIKAEEIDLSENPGLVTYMRTPLQAIASPRLPSHLYK 1529

HSP 3
Score: 56.0524 bits (116), Expect = 3.69561e-17
Identity = 31/91 (34.07%), Postives = 48/91 (52.75%), Query Frame = -1
Query:   89 EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDL 361
E G KL W+ P WI YGPNI+ +L +V+A +F + +WG RV+P ++L V + + F ++P ++ V LLL L
Sbjct: 993 EPLGTKLSWILPHCWIXCYGPNINVNI*SLRDVIATNFNISIGSVRKHQWGRRVQP*CLFGYTL*VR*VRKIGFXHDPFKTNHTV*LLLGL 1265

HSP 4
Score: 36.3494 bits (73), Expect = 3.69561e-17
Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = -2
Query:  385 PKLIPAHILRPAPNGMXSKSFPLIST 462
P P H RPAPNG KS P +ST
Sbjct: 1277 PSCAPGHTRRPAPNGSSRKSCPFMST 1354

HSP 5
Score: 29.4763 bits (58), Expect = 3.69561e-17
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = -2
Query:   10 WTWARILGCRMSSAKAHSTVLDDVSVPAV 96
W + LG +SSA HST + VS+PAV
Sbjct: 914 WAFCCTLGFFISSAIPHSTEIAVVSMPAV 1000

CCall_contig3572_v21.56118e-6151.24%
CCall_contig3572_v2
HSP 1
Score: 159.149 bits (341), Expect = 1.56118e-61
Identity = 62/121 (51.24%), Postives = 83/121 (68.60%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+MF AGTDT+ T++W + ELI +PK+L + Q E+ S+VG R V E DL +L Y++AV+KE FRLHP P+ +PR + E IDGY+IP + VN WAI RDP+ W NP F PERF+
Sbjct: 600 DMFAAGTDTTFITLDWGMTELIMNPKVLQRAQAEVRSIVGERRAVLESDLPKLHYMKAVIKEIFRLHPPAPVLVPRESMEEVNIDGYNIPAKTRFFVNAWAIGRDPESWENPYVFEPERFM 962

HSP 2
Score: 94.5419 bits (200), Expect = 1.56118e-61
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
VD KG FE IPFGAGRR C ++ G V+L A L+H++DW+LP G+ + L+M E +G+T+ R A L+V PR
Sbjct: 360 VDFKGQHFELIPFGAGRRSCPAITFGTASVELALAQLLHSFDWELPPGITAKDLDMTEVFGITMHRIADLIVIAKPR 590

HSP 3
Score: 51.0121 bits (105), Expect = 1.99748e-17
Identity = 29/76 (38.16%), Postives = 36/76 (47.37%), Query Frame = -2
Query:  385 GQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 612
G TI+ A C V P S + + P G SQS A S T+ P +I +L PAP G+ SK PL ST
Sbjct: 364 GLAITIRSAILCIVMPKTSVISKSLAVIPGGSSQSKLWRS*ARASSTLAVPNVIAGQLLLPAPKGISSKCCPLKST 591

HSP 4
Score: 47.8046 bits (98), Expect = 1.99748e-17
Identity = 19/55 (34.55%), Postives = 29/55 (52.73%), Query Frame = -1
Query:  164 PLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEV 328
P FW++ Y P+ID K WN+VAI+ F +W W R++ + D S +
Sbjct: 636 PRFWVSPYCPSIDKKPCFGWNIVAINVHFFHGFSWD*XWSRRMQSKDLFDDSFHI 800

HSP 5
Score: 23.9778 bits (46), Expect = 1.99748e-17
Identity = 11/28 (39.29%), Postives = 15/28 (53.57%), Query Frame = -1
Query:    2 QDLRVPDEFG*GPFHCAR*RVSACREHI 85
QD RV D+F P +S+C +HI
Sbjct: 879 QDFRVHDKFCHSPVKRDESCISSCSKHI 962

CCall_contig41595_v21.78071e-5945.45%
CCall_contig41595_v2
HSP 1
Score: 146.778 bits (314), Expect = 1.78071e-59
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ G DTS + +EWA+AEL++ P ++ + +ELD V+GR+R V E D+ QL Y++A+VKET R HP L P +A C++ GY I KG+ + +N W+I RDP W P EF P RFL
Sbjct: 364 DLLAGGVDTSVTIMEWAMAELLKQPPLIKKATEELDRVIGRERWVEEKDIPQLPYIEAIVKETMRKHPVAGLLXPXLAXXDCDVXGYKIQKGTRVFINTWSIGRDPSLWDAPEEFCPXRFL 726

HSP 2
Score: 100.04 bits (212), Expect = 1.78071e-59
Identity = 38/83 (45.78%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG FE +PFG+GRR+C G SLGL++V A ++H ++W LPD + E L+MDE YG PL PRL H+Y
Sbjct: 736 IDVKGQXFELLPFGSGRRMCPGYSLGLKVVSSTLANMLHGFNWKLPDNMXCEDLSMDEVYGXATSXKFPLXAVMEPRLXLHLY 984

CCall_contig44269_v21.47435e-5752.89%
CCall_contig44269_v2
HSP 1
Score: 160.982 bits (345), Expect = 1.47435e-57
Identity = 64/121 (52.89%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+SSTVEWAL ELI +PK +A+ EL V+G+DRL E+D+++ +LQA+VKET RLHP P +P A E+ G+ +PK + +LVNVWA+ RD WTNP F PERFL
Sbjct: 312 DLFIAGIDTTSSTVEWALXELINNPKKMAKAXDELXEVLGKDRLXQEVDISKFPFLQAIVKETLRLHPPAPFLVPHKAETEVELGGFTVPKNAQILVNVWAMGRDSSIWTNPDLFMPERFL 674

HSP 2
Score: 79.421 bits (167), Expect = 1.47435e-57
Identity = 30/59 (50.85%), Postives = 41/59 (69.49%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEA 562
+D KG +FE PFGAGRRIC G+ L RMV L+ A+LVH ++W L + PE ++M E+
Sbjct: 684 IDFKGQNFELXPFGAGRRICPGLPLANRMVHLMLASLVHFFNWKLAXEMNPENMDMSES 860

CCall_contig8236_v22.89982e-5750.00%
CCall_contig8236_v2
HSP 1
Score: 159.607 bits (342), Expect = 2.89982e-57
Identity = 64/128 (50.00%), Postives = 88/128 (68.75%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHV 388
+ A TDTS+ T+ WAL+ L+++P+ L +VQ+ELD VGR R V E D+ L YLQA++KET RL+P+ PL LP + E C + GYH+P G+ LLVN+ + RDP W +P EFRPERFL + +V
Sbjct: 1090 LIVAATDTSTITLTWALSLLLKNPETLTKVQEELDIYVGRQRQVKESDMKNLVYLQAILKETMRLYPAXPLLLPHESMEDCTLVGYHVPAGTRLLVNLLKLHRDPNVWVDPSEFRPERFLTTHKDVNV 1473

HSP 2
Score: 65.6747 bits (137), Expect = 2.89982e-57
Identity = 24/46 (52.17%), Postives = 36/46 (78.26%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
V+++G +FE IPFG+GRRIC G+S L+++QL ATL+HA++ P
Sbjct: 1465 VNVRGQNFELIPFGSGRRICPGISFALQVMQLTLATLLHAFEISSP 1602

HSP 3
Score: 32.6837 bits (65), Expect = 2.89982e-57
Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 2
Query:  539 EKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
E ++M E GLT +A PL V+ PRL + VY
Sbjct: 1609 EPVDMTEKGGLTNPKATPLEVYLTPRLHAQVY 1704

HSP 4
Score: 61.0927 bits (127), Expect = 7.94956e-20
Identity = 31/66 (46.97%), Postives = 35/66 (53.03%), Query Frame = -2
Query:  166 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR 363
R SG NS G H FGSR + LT+ P G W*P+ Q S G SG G+ R VSL AWR
Sbjct: 1251 RNLSGRNSLGSTHTFGSRWSFRRLTRSRVPAGTW*PTKVQSSIDSCGNRSGXAGYKRIVSLRIAWR 1448

HSP 5
Score: 39.5569 bits (80), Expect = 7.94956e-20
Identity = 22/46 (47.83%), Postives = 24/46 (52.17%), Query Frame = -2
Query:  385 GRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 522
G S A KVA S K IP HIL P PNG+ SK +PL T
Sbjct: 1464 GLEISKACNKVASVSCITCKANEIPGHILLPLPNGINSKFWPLTLT 1601

HSP 6
Score: 30.3927 bits (60), Expect = 7.94956e-20
Identity = 12/28 (42.86%), Postives = 17/28 (60.71%), Query Frame = -2
Query:   13 WTWARILGCRMSSAKAHSTVLDDVSVPA 96
WT+ ++ G S +AH V+ DVSV A
Sbjct: 1098 WTFVKVSGFLRSKERAHVNVIVDVSVAA 1181

HSP 7
Score: 55.5941 bits (115), Expect = 5.42827e-13
Identity = 34/117 (29.06%), Postives = 54/117 (46.15%), Query Frame = -1
Query:   38 NMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHC 388
N+ + + ++F K + P W++ I+ KS A W+VV T F WQ EW R F + SLE+ ++ +*F + P+S V LD LR+ ++ P C
Sbjct: 1123 NINILVSCKKSFRSKFTRIHPHIWVSMEFQKINKKSCACWDVVTNQXTIFH*LVWQ*EWXSRX*XHCFFEDSLEIYQIFHI*FLHLPLSTDIDV*FFLDFC*GLRIFEK*RKSPCQC 1473

HSP 8
Score: 34.9748 bits (70), Expect = 5.42827e-13
Identity = 11/23 (47.83%), Postives = 17/23 (73.91%), Query Frame = -1
Query:  383 PSTYSTPSTKWYXFKXISLNINM 451
P YS+ ++KWY FK ++ NIN+
Sbjct: 1462 PGAYSSTTSKWYQFKILASNINI 1530

Blast Hits to Contigs V2 CC454

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_CC454_contigs_v2)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
CC454_contig4720_v22.55796e-12696.34%
CC454_contig4720_v2
HSP 1
Score: 448.279 bits (972), Expect = 2.55796e-126
Identity = 184/191 (96.34%), Postives = 189/191 (98.95%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLT 574
NMFTAGTDTSSSTVEWA+AELIRHPK+LAQVQQELDSVVGRDRLVGELDLAQL YLQAVVKETFRLHPSTPLSLPRMAAESCEI+GYHIPKGSTLLVNVWAI+RDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFE IPFGAGRRICAGMSLGLRMVQLLTATLVHA+DWDLPDGLMPEKLNMDEAYGLT
Sbjct: 2 NMFTAGTDTSSSTVEWAIAELIRHPKVLAQVQQELDSVVGRDRLVGELDLAQLXYLQAVVKETFRLHPSTPLSLPRMAAESCEINGYHIPKGSTLLVNVWAIARDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEAIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWDLPDGLMPEKLNMDEAYGLT 574

HSP 2
Score: 404.749 bits (877), Expect = 3.24843e-113
Identity = 173/191 (90.58%), Postives = 176/191 (92.15%), Query Frame = 3
Query:    3 ICSRQALTRHLAQWNGP*PNSSGTLRSWPKSNKSLTPLWAETGS*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQRAPLF*SMFGPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREMXLKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TWMRHMG*P 575
ICSRQALT HLAQWNGP*PNSSGT RSWPKSNKSLTPLWAE GS*VN T*PNSL SRLWSRK SGSTLQP SLCHAW+PKV KSMATTFQRAPLF*SMFGP VIQNNGPTH*SLG NASYRVAKRPMLI REM LK YHLVLGVE+VLG*A*VYAWFNY*L P*FMH+IGTCLMD*CLRN*TWMRHMG*P
Sbjct: 1 ICSRQALTHHLAQWNGP*PNSSGTPRSWPKSNKSLTPLWAEIGS*VNWT*PNSLISRLWSRKHSGSTLQPRSLCHAWRPKVAKSMATTFQRAPLF*SMFGP*HVIQNNGPTH*SLGRNASYRVAKRPMLISREMILKPYHLVLGVEFVLG*A*VYAWFNY*LLP*FMHLIGTCLMD*CLRN*TWMRHMG*P 573

HSP 3
Score: 402.916 bits (873), Expect = 1.15071e-112
Identity = 173/191 (90.58%), Postives = 176/191 (92.15%), Query Frame = -1
Query:    2 GQPICLIHVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFKXISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI 574
GQPICLIHVQFLRHQSIRQVPI CMN*G S**LNHA*T*AHPST STPSTKWY FK ISL+INMGLFATR*EAF PKL*WVGPLFWIT YGPNID*KSGALWNVVAIDF TFG HAWQRE G*RVEPE FLDHSLE+SELG*V FTYEP+SAHNGVKLLLDLGQDL VPDEFG GPFHCAR* VSACREHI
Sbjct: 2 GQPICLIHVQFLRHQSIRQVPIKCMN*GSS**LNHA*T*AHPSTNSTPSTKWYGFKIISLDINMGLFATR*EAFRPKL*WVGPLFWITCYGPNID*KSGALWNVVAIDFATFGRHAWQRERG*RVEPECFLDHSLEISELG*VQFTYEPISAHNGVKLLLDLGQDLGVPDEFGYGPFHCAR*CVSACREHI 574

HSP 4
Score: 332.81 bits (720), Expect = 3.50034e-109
Identity = 136/154 (88.31%), Postives = 137/154 (88.96%), Query Frame = -3
Query:  105 HMPHPCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQXHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWPKH*LKEWSPLECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLRAGLGPQRSQ 566
HMPHPCSVSQASIHQAGPN MHELR QL VEPCVNLSSSQH FYAQHQMV LQ HFP*YQHGPFRYPVGSV A*TLMGWSIVLDH +WPKH*LKEWSPLECGSH F NFR PCVAER GLKGGAG FP*PQPG K VGLG IHLRA LGPQRSQ
Sbjct: 10 HMPHPCSVSQASIHQAGPNQMHELR*QLIVEPCVNLSSSQHKFYAQHQMVWLQNHFP*YQHGPFRYPVGSVPA*TLMGWSIVLDHVLWPKH*LKEWSPLECGSH*FRNFRPPCVAERAGLKGGAGMFP*PQPGDKXVGLGPIHLRADLGPQRSQ 471

HSP 5
Score: 79.8792 bits (168), Expect = 3.50034e-109
Identity = 31/33 (93.94%), Postives = 31/33 (93.94%), Query Frame = -2
Query:    1 CWTWARILGCRMSSAKAHSTVLDDVSVPAVNIF 99
CWTWAR LGCRMSSA AHSTVLDDVSVPAVNIF
Sbjct: 477 CWTWARTLGCRMSSAMAHSTVLDDVSVPAVNIF 575

HSP 6
Score: 387.795 bits (840), Expect = 4.12335e-108
Identity = 160/191 (83.77%), Postives = 165/191 (86.39%), Query Frame = 1
Query:    1 EYVHGRH*HVI*HSGMGLSRTHPAP*DPGPSPTRA*LRCGXXXXXXXXXXXXTHLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSKGLHSFSQCLGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK*X*SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG*GIWAD 573
EYVHGRH*H+I*HSGMG SRTHPAP PGPSPTRA*LRCG T L PGCGQGN+PAPPFNP LSATHG RKL N+WLPHSKGLHSFSQCLGH +*SKTMDQPIRV*A TLPTG*RKGPC*Y GK* *SHTIWCWA*N+CWDELRFTHGST NC LSSCI*LGPA*WIDA*ETEHG*GIWAD
Sbjct: 3 EYVHGRH*HII*HSGMGHSRTHPAPQGPGPSPTRA*LRCGPRSARR*IGPSPTXLSPGCGQGNIPAPPFNPALSATHGGRKLRNQWLPHSKGLHSFSQCLGHST*SKTMDQPIRV*AGTLPTG*RKGPC*YQGK*F*SHTIWCWA*NLCWDELRFTHGSTINCYLSSCI*LGPA*WIDA*ETEHG*GIWAD 575

HSP 7
Score: 308.067 bits (666), Expect = 6.52167e-91
Identity = 133/141 (94.33%), Postives = 133/141 (94.33%), Query Frame = -2
Query:  151 VSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 573
VSPYASSMFSFSGINPSGRSQS A*TKVAV S*TMRKPKLIPA ILRPAPNGM SKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSR MAQTLTKRVEPFGMW*P ISQLSAAMRGRESGVEGWSR VSLTTAWR* SWA
Sbjct: 3 VSPYASSMFSFSGINPSGRSQSNA*TKVAVNS*TMRKPKLIPAQILRPAPNGMASKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRAMAQTLTKRVEPFGMW*PLISQLSAAMRGRESGVEGWSRNVSLTTAWR*XSWA 425

HSP 8
Score: 43.6807 bits (89), Expect = 6.52167e-91
Identity = 17/19 (89.47%), Postives = 17/19 (89.47%), Query Frame = -3
Query:    3 RLRPIPLC*MTCQCLP*TY 59
RL PIPLC*M CQCLP*TY
Sbjct: 517 RLWPIPLC*MMCQCLP*TY 573

CC454_contig21637_v23.9778e-6856.41%
CC454_contig21637_v2
HSP 1
Score: 169.688 bits (364), Expect = 3.9778e-68
Identity = 66/117 (56.41%), Postives = 85/117 (72.65%), Query Frame = 2
Query:   14 AGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
A DTS++ ++W L ELIRHP+I+ +VQ+EL++VVG +R+V E DL L YL VVKET RLHP PL +P + E C I+ YHIP+ S LL+NVWAI RDP WT P +F PERF+
Sbjct: 9 ASMDTSATAIDWMLTELIRHPRIMKKVQKELENVVGLERMVDESDLDSLEYLDMVVKETMRLHPVAPLLIPHESLEDCTINDYHIPRKSRLLINVWAIGRDPSVWTEPDKFNPERFI 359

HSP 2
Score: 105.997 bits (225), Expect = 3.9778e-68
Identity = 40/80 (50.00%), Postives = 60/80 (75.00%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
+++D++G+D E IPFG+GRR C GM LGL +V+L+ A LVH++DW+LP+ ++P +L+M E +GLT RA L+ P RL
Sbjct: 363 SNIDLRGHDLELIPFGSGRRSCPGMQLGLTVVRLVLAQLVHSFDWELPNDMLPTELDMTEEFGLTTPRAKHLLAIPTYRL 602

HSP 3
Score: 48.721 bits (100), Expect = 4.30991e-20
Identity = 28/62 (45.16%), Postives = 33/62 (53.23%), Query Frame = -2
Query:  388 VSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIS 573
V P +S M + G G SQS *T A S T +P IP +L P PNG+ SKS PL S
Sbjct: 371 VRPNSSVMSNSVGNMSLGSSQSKL*TSCANTSRTTVRPNCIPGQLLLPDPNGISSKSCPLRS 556

HSP 4
Score: 45.9718 bits (94), Expect = 4.30991e-20
Identity = 26/60 (43.33%), Postives = 30/60 (50.00%), Query Frame = -2
Query:  175 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTT 354
SGLN +G V GS +A T K ++ GMW* I Q S G G G S VS TT
Sbjct: 170 SGLNLSGSVQTLGSLPIAHTFIKSLDLRGMW*SLIVQSSNDS*GINKGATGCSLMVSFTT 349

HSP 5
Score: 37.2658 bits (75), Expect = 4.30991e-20
Identity = 21/58 (36.21%), Postives = 31/58 (53.45%), Query Frame = -1
Query:   23 PEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RV 196
P GF + ++V + V F Y P+ AH+ +LLL+ R+PD F P +C * V
Sbjct: 18 PHGFFYNHVQVLQAIQVRFIYHPL*AHHIFQLLLNFLHYTRMPD*FREHPINCCC*SV 191

CC454_contig33621_v29.28517e-6749.59%
CC454_contig33621_v2
HSP 1
Score: 160.982 bits (345), Expect = 9.28517e-67
Identity = 60/121 (49.59%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ GT++S+ TVEWA++E+++ P+I + +ELD V+GRDR V E D+ L Y+ A++KET RLHP P+ +PR++ E C I GY I KG+ +LVNVW I RDP W P EF PERF+
Sbjct: 520 DLIAGGTESSAVTVEWAISEILKKPEIFKKATEELDRVIGRDRWVEEKDIVNLPYIDAIIKETMRLHPVAPMLVPRLSREDCNIAGYDILKGTRVLVNVWTIGRDPTIWDKPNEFYPERFV 882

HSP 2
Score: 110.121 bits (234), Expect = 9.28517e-67
Identity = 41/83 (49.40%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG+DFE +PFGAGRR+C G SLGL+++Q + L+H + W LP+ + E LNM+E +GL+ + PL V PRL HVY
Sbjct: 262 IDVKGHDFELLPFGAGRRMCPGYSLGLKVIQSSLSNLLHGFTWSLPENMKTEDLNMEEIFGLSTPKKFPLEVVVKPRLPKHVY 510

HSP 3
Score: 41.3897 bits (84), Expect = 3.57525e-14
Identity = 22/66 (33.33%), Postives = 31/66 (46.97%), Query Frame = -1
Query:  164 EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEV 361
E+F K W+ P WI+ GP I G NV+A + F W RV+P FL++ + V
Sbjct: 523 ESFRIKFIWLVPYCWISSNGPYIYKHPGTFENVIASNVAIFAR*TRY*HWCHRVQPHCFLNNCINV 720

HSP 4
Score: 40.4733 bits (82), Expect = 3.57525e-14
Identity = 16/26 (61.54%), Postives = 19/26 (73.08%), Query Frame = -2
Query:  388 KPKLIPAHILRPAPNGMXSKSFPLIS 465
+P+L P HIL PAP G SKS+PL S
Sbjct: 431 RPRL*PGHILLPAPKGSSSKSWPLTS 508

HSP 5
Score: 23.9778 bits (46), Expect = 3.57525e-14
Identity = 17/39 (43.59%), Postives = 18/39 (46.15%), Query Frame = -2
Query:  517 *TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGR 633
*TC SLG T G SP SSMF S SG+
Sbjct: 263 *TCFGSLGFTTTSSGNFLGVESPNISSMFKSSVFMFSGK 379

HSP 6
Score: 22.1449 bits (42), Expect = 3.57525e-14
Identity = 11/23 (47.83%), Postives = 14/23 (60.87%), Query Frame = -2
Query:   16 RILGCRMSSAKAHSTVLDDVSVP 84
+I G S AHSTV ++SVP
Sbjct: 800 KISGFFSISEIAHSTVTAELSVP 868

CC454_contig26293_v21.16545e-6549.59%
CC454_contig26293_v2
HSP 1
Score: 160.524 bits (344), Expect = 1.16545e-65
Identity = 60/121 (49.59%), Postives = 87/121 (71.90%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+S+ +EW +AELI +P++L++ ++EL+ ++G+ E D+++L YLQA+VKETFRLHP PL LPR A EI G+ + KG+ +LVN WAI RD W NP F+PERF+
Sbjct: 279 DLFIAGNDTTSAALEWTMAELIHNPEVLSKAKEELNQIIGKGNPXEESDISRLPYLQAIVKETFRLHPPVPLLLPRKAEADVEIQGFTVXKGAQVLVNAWAIGRDSSIWENPNSFKPERFM 641

HSP 2
Score: 106.914 bits (227), Expect = 1.16545e-65
Identity = 38/76 (50.00%), Postives = 55/76 (72.37%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHP 607
+ +D+KG +FE IPFGAGRRIC G+ L +RM+ L+ +L+H +DW L DG PE ++M++ +GL+LQ A PL P
Sbjct: 645 SEIDVKGRNFELIPFGAGRRICPGLPLAIRMLHLMLGSLIHTFDWRLEDGFKPEDMSMEDKFGLSLQLAQPLRAIP 872

HSP 3
Score: 51.9285 bits (107), Expect = 4.03713e-19
Identity = 27/61 (44.26%), Postives = 32/61 (52.46%), Query Frame = -2
Query:  172 SGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTA 354
SGLN G H S +A T PF P IS ++A+RG SG G +RKVSLT A
Sbjct: 449 SGLNEFGFSHMLESLPIAHAFTSTCAPFXTVKP*ISTSASALRGSNSGTGGCNRKVSLTIA 631

HSP 4
Score: 34.5166 bits (69), Expect = 4.03713e-19
Identity = 14/21 (66.67%), Postives = 15/21 (71.43%), Query Frame = -2
Query:  388 PAHILRPAPNGMXSKSFPLIS 450
P HIL PAPNG+ SK PL S
Sbjct: 653 PGHILLPAPNGISSKFRPLTS 715

HSP 5
Score: 30.3927 bits (60), Expect = 4.03713e-19
Identity = 15/33 (45.45%), Postives = 17/33 (51.52%), Query Frame = -2
Query:  508 GCTIKGAARCKVSPYASSMFSFSGINPSGRSQS 606
G +G A CK P SSM SG+ PS QS
Sbjct: 773 GIARRG*ANCKDKPNLSSMDISSGLKPSSSLQS 871

HSP 6
Score: 28.5598 bits (56), Expect = 4.03713e-19
Identity = 13/26 (50.00%), Postives = 16/26 (61.54%), Query Frame = -2
Query:    7 RILGCRMSSAKAHSTVLDDVSVPAVN 84
R G +SSA HS D VS+PA+N
Sbjct: 284 RTSGL*ISSAIVHSNAADVVSLPAIN 361

CC454_contig17767_v21.05838e-6454.55%
CC454_contig17767_v2
HSP 1
Score: 171.521 bits (368), Expect = 1.05838e-64
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M TAG DT++ +VEW +AELI++P++ + Q+ELD V+G +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NP EFRPERFL
Sbjct: 464 DMITAGMDTTAISVEWGMAELIKNPRVQQKAQEELDRVIGFERVMTEADFSNLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAXWKNPAEFRPERFL 826

HSP 2
Score: 92.709 bits (196), Expect = 1.05838e-64
Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+G+ E++++ E GL PL PRL SH+Y+
Sbjct: 203 VDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFVWTPPEGIKAEEIDLSENPGLVTYMRTPLQAIASPRLPSHLYK 454

HSP 3
Score: 52.3867 bits (108), Expect = 4.1119e-16
Identity = 30/91 (32.97%), Postives = 47/91 (51.65%), Query Frame = -1
Query:   89 EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDL 361
E G KL W+ P WI GPNI+ +L +V+A +F + +WG RV+P ++L V + + F ++P ++ V LLL L
Sbjct: 467 EPLGTKLSWILPHCWIXCXGPNINVNI*SLRDVIATNFNISIGSVRKHQWGRRVQP*CLFGYTL*VR*VRKIGFXHDPFKTNHTV*LLLGL 739

HSP 4
Score: 36.3494 bits (73), Expect = 4.1119e-16
Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = -2
Query:  385 PKLIPAHILRPAPNGMXSKSFPLIST 462
P P H RPAPNG KS P +ST
Sbjct: 378 PSCAPGHTRRPAPNGSSRKSCPFMST 455

HSP 5
Score: 29.4763 bits (58), Expect = 4.1119e-16
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = -2
Query:   10 WTWARILGCRMSSAKAHSTVLDDVSVPAV 96
W + LG +SSA HST + VS+PAV
Sbjct: 732 WAFCCTLGFFISSAIPHSTEIAVVSMPAV 818

CC454_contig45629_v21.23039e-6154.55%
CC454_contig45629_v2
HSP 1
Score: 170.146 bits (365), Expect = 1.23039e-61
Identity = 66/121 (54.55%), Postives = 89/121 (73.55%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+SSTVEWALAELI +PK +A+ Q EL+ V+G+DRL+ E+D+++ +LQA+VKET RLHP P +P A E+ G+ +PK + +LVNVWA+ RD WTNP F PERFL
Sbjct: 983 DLFIAGIDTTSSTVEWALAELINNPKKMAKAQDELEEVLGKDRLIQEVDISKXPFLQAIVKETLRLHPPAPFLVPHKAETXVELGGFXVPKNAQILVNVWAMGRDSSIWTNPXLFMPERFL 1345

HSP 2
Score: 75.2971 bits (158), Expect = 1.23039e-61
Identity = 31/58 (53.45%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDE 559
+ KG FE IPFGAGRRIC G+ RMV L+ A+LVH +W L D + PE L+M E
Sbjct: 1355 IXFKGKYFELIPFGAGRRICPGLPXANRMVPLMLASLVHFINWKLADEMNPEDLDMSE 1528

HSP 3
Score: 27.1852 bits (53), Expect = 1.23039e-61
Identity = 11/21 (52.38%), Postives = 15/21 (71.43%), Query Frame = 2
Query:  545 LNMDEAYGLTLQRAAPLMVHP 607
++ +E +GLTL RA PL V P
Sbjct: 1520 MSENEIFGLTLXRAKPLRVIP 1582

CC454_contig2378_v21.5032e-6151.24%
CC454_contig2378_v2
HSP 1
Score: 159.149 bits (341), Expect = 1.5032e-61
Identity = 62/121 (51.24%), Postives = 83/121 (68.60%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+MF AGTDT+ T++W + ELI +PK+L + Q E+ S+VG R V E DL +L Y++AV+KE FRLHP P+ +PR + E IDGY+IP + VN WAI RDP+ W NP F PERF+
Sbjct: 600 DMFAAGTDTTFITLDWGMTELIMNPKVLQRAQAEVRSIVGERRAVLESDLPKLHYMKAVIKEIFRLHPPAPVLVPRESMEEVNIDGYNIPAKTRFFVNAWAIGRDPESWENPYVFEPERFM 962

HSP 2
Score: 94.5419 bits (200), Expect = 1.5032e-61
Identity = 37/77 (48.05%), Postives = 51/77 (66.23%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPR 616
VD KG FE IPFGAGRR C ++ G V+L A L+H++DW+LP G+ + L+M E +G+T+ R A L+V PR
Sbjct: 360 VDFKGQHFELIPFGAGRRSCPAITFGTASVELALAQLLHSFDWELPPGITAKDLDMTEVFGITMHRIADLIVIAKPR 590

HSP 3
Score: 51.0121 bits (105), Expect = 1.9233e-17
Identity = 29/76 (38.16%), Postives = 36/76 (47.37%), Query Frame = -2
Query:  385 GQGCTIKGAARCKVSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 612
G TI+ A C V P S + + P G SQS A S T+ P +I +L PAP G+ SK PL ST
Sbjct: 364 GLAITIRSAILCIVMPKTSVISKSLAVIPGGSSQSKLWRS*ARASSTLAVPNVIAGQLLLPAPKGISSKCCPLKST 591

HSP 4
Score: 47.8046 bits (98), Expect = 1.9233e-17
Identity = 19/55 (34.55%), Postives = 29/55 (52.73%), Query Frame = -1
Query:  164 PLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEV 328
P FW++ Y P+ID K WN+VAI+ F +W W R++ + D S +
Sbjct: 636 PRFWVSPYCPSIDKKPCFGWNIVAINVHFFHGFSWD*XWSRRMQSKDLFDDSFHI 800

HSP 5
Score: 23.9778 bits (46), Expect = 1.9233e-17
Identity = 11/28 (39.29%), Postives = 15/28 (53.57%), Query Frame = -1
Query:    2 QDLRVPDEFG*GPFHCAR*RVSACREHI 85
QD RV D+F P +S+C +HI
Sbjct: 879 QDFRVHDKFCHSPVKRDESCISSCSKHI 962

CC454_contig42097_v21.71458e-5945.45%
CC454_contig42097_v2
HSP 1
Score: 147.236 bits (315), Expect = 1.71458e-59
Identity = 55/121 (45.45%), Postives = 79/121 (65.29%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ G DTS + +EWA+AEL++ P ++ + +ELD V+GR+R V E D+ QL Y++A+VKET R HP L P +A C++ GY I KG+ + +N W+I RDP W P EF P RFL
Sbjct: 364 DLLAGGVDTSVTIMEWAMAELLKQPPLIKKATEELDRVIGRERWVEEKDIPQLPYIEAIVKETMRKHPVAGLLXPXLAXXDCDVXGYKIQKGTRVFINTWSIGRDPSXWDAPEEFCPXRFL 726

HSP 2
Score: 99.5822 bits (211), Expect = 1.71458e-59
Identity = 38/83 (45.78%), Postives = 52/83 (62.65%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG FE +PFG+GRR+C G SLGL++V A ++H ++W LPD + E L+MDE YG PL PRL H+Y
Sbjct: 736 IDVKGQXFELLPFGSGRRMCPGYSLGLKVVSSTLANMLHGFNWKLPDNMXCEDLSMDEVYGXATSLKFPLXAVMEPRLXLHLY 984

CC454_contig8185_v22.79213e-5750.00%
CC454_contig8185_v2
HSP 1
Score: 159.607 bits (342), Expect = 2.79213e-57
Identity = 64/128 (50.00%), Postives = 88/128 (68.75%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHV 388
+ A TDTS+ T+ WAL+ L+++P+ L +VQ+ELD VGR R V E D+ L YLQA++KET RL+P+ PL LP + E C + GYH+P G+ LLVN+ + RDP W +P EFRPERFL + +V
Sbjct: 1090 LIVAATDTSTITLTWALSLLLKNPETLTKVQEELDIYVGRQRQVKESDMKNLVYLQAILKETMRLYPAXPLLLPHESMEDCTLVGYHVPAGTRLLVNLLKLHRDPNVWVDPSEFRPERFLTTHKDVNV 1473

HSP 2
Score: 65.6747 bits (137), Expect = 2.79213e-57
Identity = 24/46 (52.17%), Postives = 36/46 (78.26%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
V+++G +FE IPFG+GRRIC G+S L+++QL ATL+HA++ P
Sbjct: 1465 VNVRGQNFELIPFGSGRRICPGISFALQVMQLTLATLLHAFEISSP 1602

HSP 3
Score: 32.6837 bits (65), Expect = 2.79213e-57
Identity = 15/32 (46.88%), Postives = 20/32 (62.50%), Query Frame = 2
Query:  539 EKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
E ++M E GLT +A PL V+ PRL + VY
Sbjct: 1609 EPVDMTEKGGLTNPKATPLEVYLTPRLHAQVY 1704

HSP 4
Score: 61.0927 bits (127), Expect = 7.65435e-20
Identity = 31/66 (46.97%), Postives = 35/66 (53.03%), Query Frame = -2
Query:  166 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR 363
R SG NS G H FGSR + LT+ P G W*P+ Q S G SG G+ R VSL AWR
Sbjct: 1251 RNLSGRNSLGSTHTFGSRWSFRRLTRSRVPAGTW*PTKVQSSIDSCGNRSGXAGYKRIVSLRIAWR 1448

HSP 5
Score: 39.5569 bits (80), Expect = 7.65435e-20
Identity = 22/46 (47.83%), Postives = 24/46 (52.17%), Query Frame = -2
Query:  385 GRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLIST 522
G S A KVA S K IP HIL P PNG+ SK +PL T
Sbjct: 1464 GLEISKACNKVASVSCITCKANEIPGHILLPLPNGINSKFWPLTLT 1601

HSP 6
Score: 30.3927 bits (60), Expect = 7.65435e-20
Identity = 12/28 (42.86%), Postives = 17/28 (60.71%), Query Frame = -2
Query:   13 WTWARILGCRMSSAKAHSTVLDDVSVPA 96
WT+ ++ G S +AH V+ DVSV A
Sbjct: 1098 WTFVKVSGFLRSKERAHVNVIVDVSVAA 1181

HSP 7
Score: 55.5941 bits (115), Expect = 5.22668e-13
Identity = 34/117 (29.06%), Postives = 54/117 (46.15%), Query Frame = -1
Query:   38 NMGLFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHC 388
N+ + + ++F K + P W++ I+ KS A W+VV T F WQ EW R F + SLE+ ++ +*F + P+S V LD LR+ ++ P C
Sbjct: 1123 NINILVSCKKSFRSKFTRIHPHIWVSMEFQKINKKSCACWDVVTNQXTIFH*LVWQ*EWXSRX*XHCFFEDSLEIYQIFHI*FLHLPLSTDIDV*FFLDFC*GLRIFEK*RKSPCQC 1473

HSP 8
Score: 34.9748 bits (70), Expect = 5.22668e-13
Identity = 11/23 (47.83%), Postives = 17/23 (73.91%), Query Frame = -1
Query:  383 PSTYSTPSTKWYXFKXISLNINM 451
P YS+ ++KWY FK ++ NIN+
Sbjct: 1462 PGAYSSTTSKWYQFKILASNINI 1530

CC454_contig11076_v26.51276e-5660.26%
CC454_contig11076_v2
HSP 1
Score: 113.787 bits (242), Expect = 6.51276e-56
Identity = 47/78 (60.26%), Postives = 54/78 (69.23%), Query Frame = 2
Query:  131 LVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ E L QL YLQA VKET RLHP PL LP A ES ++ Y IPK S +LVNVWAI RDP W +PL F+PERFL
Sbjct: 191 VIKEFHLPQLNYLQASVKETLRLHPPAPLLLPHRAIESYQVTSYTIPKDSQVLVNVWAIGRDPLYWEDPLVFKPERFL 424

HSP 2
Score: 89.5016 bits (189), Expect = 6.51276e-56
Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAY 565
+D KGNDFE +PF AGRRIC G+ + ++V L+ A+L+H +DW LP G PEKL+M E +
Sbjct: 2 LDFKGNDFEFLPFSAGRRICPGLPMAAKVVPLVLASLIHNFDWSLPHGYDPEKLDMSEKF 181

HSP 3
Score: 50.0956 bits (103), Expect = 6.51276e-56
Identity = 19/41 (46.34%), Postives = 33/41 (80.49%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRD 127
+F+AGT+TSSST+ WA+AELI++ + + +V++EL + +D
Sbjct: 425 LFSAGTETSSSTIVWAMAELIKNLESMKKVREELAREIKQD 547

Blast Hits to Contigs V2 AC454

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_AC454_contigs_v2)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
AC454_contig12329_v29.67768e-7860.16%
AC454_contig12329_v2
HSP 1
Score: 198.555 bits (427), Expect = 9.67768e-78
Identity = 74/123 (60.16%), Postives = 97/123 (78.86%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPG 370
N+FTAGTDTSSS +EWAL E++++P IL + E+D V+GR+R + E D+A+L YLQA+ KET R HPSTPL+LPR++ E CE++GY+IPK + L VN+WAI RDP W NPL+F PERFL G
Sbjct: 951 NLFTAGTDTSSSIIEWALTEMLKNPSILKRAHDEMDQVIGRNRRLEEADIAKLPYLQAICKETMRKHPSTPLNLPRVSTEDCEVNGYYIPKNTRLSVNIWAIGRDPDVWENPLDFTPERFLSG 1319

HSP 2
Score: 84.9195 bits (179), Expect = 9.67768e-78
Identity = 30/52 (57.69%), Postives = 42/52 (80.77%), Query Frame = 2
Query:  380 AHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLM 535
A +D +GNDFE IPFGAGRRICAG +G+ +V+ + TLVH++DW LP+G++
Sbjct: 1326 AKIDPRGNDFELIPFGAGRRICAGTRMGIVLVEYILGTLVHSFDWKLPNGVV 1481

HSP 3
Score: 42.3061 bits (86), Expect = 9.67768e-78
Identity = 18/31 (58.06%), Postives = 21/31 (67.74%), Query Frame = 2
Query:  542 KLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+LNMDEA+GL LQ+A PL PRLS Y
Sbjct: 1482 ELNMDEAFGLALQKAVPLSAMVSPRLSLSAY 1574

HSP 4
Score: 56.5106 bits (117), Expect = 9.52082e-26
Identity = 34/73 (46.58%), Postives = 40/73 (54.79%), Query Frame = -2
Query:  151 PGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 369
P + SG+ SNG H GSR +A T + FGM *P SQ S G+ SGVEG R VSL A R S+A
Sbjct: 1100 PLKNLSGVKSNGFSHTSGSRPIAHMFTLSLVFFGM**PFTSQSSVETLGKFSGVEGCFRIVSLHMA*RYGSFA 1318

HSP 5
Score: 54.6777 bits (113), Expect = 9.52082e-26
Identity = 28/56 (50.00%), Postives = 32/56 (57.14%), Query Frame = -2
Query:  376 FSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAF 543
FS P G QS T V T P L+PA IL PAPNG+ SKSFPL S +A+
Sbjct: 1322 FSSTTPFGNFQSNECTNVPRMYSTSTIPILVPAQILLPAPNGINSKSFPLGSIFAY 1489

HSP 6
Score: 39.0986 bits (79), Expect = 9.52082e-26
Identity = 18/28 (64.29%), Postives = 20/28 (71.43%), Query Frame = -2
Query:    1 RILGCRMSSAKAHSTVLDDVSVPAVNIF 84
R+LG S AHS +LDDVSVPAVN F
Sbjct: 950 RMLGFFNISVSAHSIMLDDVSVPAVNKF 1033

HSP 7
Score: 45.5136 bits (93), Expect = 3.0023e-11
Identity = 19/43 (44.19%), Postives = 26/43 (60.47%), Query Frame = -1
Query:  236 *EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFG 364
*++F ++*WV P +T Y P + K LWNV+AI FT G
Sbjct: 1185 *KSFWCEI*WVFPYIRVTTYCPYVHTKPSVLWNVIAIHFTVLG 1313

HSP 8
Score: 28.1016 bits (55), Expect = 3.0023e-11
Identity = 19/62 (30.65%), Postives = 31/62 (50.00%), Query Frame = -1
Query:    2 FLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRVPDEFG*GPFHCAR*RVSACREHI 187
F + L++ EL V F +S++ + ++ +D RV PF+ A * V ACRE +
Sbjct: 951 FFAYGLKIWELCYVCFL*TSISSNYLIHFIMCPLEDARVLQHLRKCPFNYA**CVGACREQV 1136

HSP 9
Score: 26.727 bits (52), Expect = 3.0023e-11
Identity = 13/28 (46.43%), Postives = 16/28 (57.14%), Query Frame = -1
Query:  368 PSTYSTPSTKWYXFKXISLNINMGLFAT 451
PST S+KW F+ IS IN +F T
Sbjct: 1314 PSTNPPSSSKWN*FEIISPWINFCIFPT 1397

AC454_contig14507_v26.62871e-6748.76%
AC454_contig14507_v2
HSP 1
Score: 160.524 bits (344), Expect = 6.62871e-67
Identity = 59/121 (48.76%), Postives = 85/121 (70.25%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++ GT++S+ TVEWA++E+++ P++ + +ELD V+GRDR V E D+ L Y+ A++KET RLHP P+ +PR++ E C I GY I KG+ +LVNVW I RDP W P EF PERF+
Sbjct: 449 DLIAGGTESSAVTVEWAISEILKKPEVFKKATEELDRVIGRDRWVEEKDIVNLPYIDAIIKETMRLHPVAPMLVPRLSREDCNIAGYDILKGTRVLVNVWTIGRDPTIWDKPNEFYPERFV 811

HSP 2
Score: 110.121 bits (234), Expect = 6.62871e-67
Identity = 41/83 (49.40%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
+D+KG+DFE +PFGAGRR+C G SLGL+++Q + L+H + W LP+ + E LNM+E +GL+ + PL V PRL HVY
Sbjct: 191 IDVKGHDFELLPFGAGRRMCPGYSLGLKVIQSSLSNLLHGFTWSLPENMKTEDLNMEEIFGLSTPKKFPLEVVVKPRLPKHVY 439

HSP 3
Score: 40.4733 bits (82), Expect = 1.45934e-12
Identity = 16/26 (61.54%), Postives = 19/26 (73.08%), Query Frame = -2
Query:  388 KPKLIPAHILRPAPNGMXSKSFPLIS 465
+P+L P HIL PAP G SKS+PL S
Sbjct: 360 RPRL*PGHILLPAPKGSSSKSWPLTS 437

HSP 4
Score: 40.4733 bits (82), Expect = 1.45934e-12
Identity = 21/72 (29.17%), Postives = 34/72 (47.22%), Query Frame = -1
Query:  164 LFATR*EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEV 379
++++ E+F K W+ P WI+ GP I G NV+ + F W RV+P FL++ + V
Sbjct: 434 IYSSPNESFRIKFIWLVPYXWISSNGPYIYKHPGTFENVITSNVAIFAR*TRY*HWCHRVQPHCFLNNCINV 649

HSP 5
Score: 23.9778 bits (46), Expect = 1.45934e-12
Identity = 17/39 (43.59%), Postives = 18/39 (46.15%), Query Frame = -2
Query:  517 *TCEESLGQGCTIKGAARCKVSPYASSMFSFSGINPSGR 633
*TC SLG T G SP SSMF S SG+
Sbjct: 192 *TCFGSLGFTTTSSGNFLGVESPNISSMFKSSVFMFSGK 308

AC454_contig19308_v24.02349e-6554.55%
AC454_contig19308_v2
HSP 1
Score: 171.979 bits (369), Expect = 4.02349e-65
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+M TAG DT++ +VEW +AELI++P++ + Q+ELD V+G +R++ E D + L YLQ V KE RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NP EFRPERFL
Sbjct: 426 DMITAGMDTTAISVEWGMAELIKNPRVQQKAQEELDRVIGFERVMTEADFSNLPYLQCVAKEALRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAMWKNPAEFRPERFL 788

HSP 2
Score: 92.709 bits (196), Expect = 4.02349e-65
Identity = 35/84 (41.67%), Postives = 52/84 (61.90%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
VD+KG+DF +PFGAGRR+C G LG+ +V + L+H + W P+G+ E++++ E GL PL PRL SH+Y+
Sbjct: 165 VDMKGHDFRLLPFGAGRRVCPGAQLGINLVTSMLGHLLHHFVWTPPEGIKAEEIDLSENPGLVTYMRTPLQAIASPRLPSHLYK 416

HSP 3
Score: 56.9688 bits (118), Expect = 1.01445e-17
Identity = 31/91 (34.07%), Postives = 49/91 (53.85%), Query Frame = -1
Query:   89 EAFGPKL*WVGPLFWITRYGPNID*KSGALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPVSAHNGVKLLLDL 361
E G KL W+ P WIT YGPNI+ +L +V++ +F + +WG RV+P ++L V + + F ++P ++ V LLL L
Sbjct: 429 EPLGTKLSWILPHCWITCYGPNINVNI*SLRDVISTNFNISIGSVRKHQWGRRVQP*CLFGYTL*VR*VRKIGFGHDPFKTNHTV*LLLGL 701

HSP 4
Score: 36.3494 bits (73), Expect = 1.01445e-17
Identity = 14/26 (53.85%), Postives = 15/26 (57.69%), Query Frame = -2
Query:  385 PKLIPAHILRPAPNGMXSKSFPLIST 462
P P H RPAPNG KS P +ST
Sbjct: 340 PSCAPGHTRRPAPNGSSRKSCPFMST 417

HSP 5
Score: 29.4763 bits (58), Expect = 1.01445e-17
Identity = 14/29 (48.28%), Postives = 18/29 (62.07%), Query Frame = -2
Query:   10 WTWARILGCRMSSAKAHSTVLDDVSVPAV 96
W + LG +SSA HST + VS+PAV
Sbjct: 694 WAFCCTLGFFISSAIPHSTEIAVVSMPAV 780

AC454_contig8733_v21.21878e-5954.55%
AC454_contig8733_v2
HSP 1
Score: 167.397 bits (359), Expect = 1.21878e-59
Identity = 66/121 (54.55%), Postives = 88/121 (72.73%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
++F AG DT+SSTVEWALAELI PK +A+ Q EL+ V+G+DRL+ E+D+++ +LQA+VKET RLHP P +P A E+ G+ +PK + +LVNVWA+ RD WTNP F PERFL
Sbjct: 913 DLFIAGIDTTSSTVEWALAELINXPKKMAKAQDELEEVLGKDRLIQEVDISKFPFLQAIVKETLRLHPPAPFLVPHKAETEVELCGFTVPKNAQILVNVWAMGRDSSIWTNPDLFMPERFL 1275

HSP 2
Score: 78.9628 bits (166), Expect = 1.21878e-59
Identity = 31/59 (52.54%), Postives = 40/59 (67.80%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEA 562
+D KG FE IPFGAGRRIC G+ L RMV L+ A+LVH ++W L D + P +M E+
Sbjct: 1285 IDFKGQXFELIPFGAGRRICPGLPLANRMVXLMLASLVHFFNWKLADEMNPXXXDMSES 1461

AC454_contig9752_v21.33644e-5496.47%
AC454_contig9752_v2
HSP 1
Score: 209.094 bits (450), Expect = 1.33644e-54
Identity = 82/85 (96.47%), Postives = 84/85 (98.82%), Query Frame = 2
Query:  299 WAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNM 553
WAI+RDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFE IPFGAGRRICAGMSLGLRMVQLLTATLVHA+DWDLPDGLMPEKLNM
Sbjct: 3 WAIARDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEAIPFGAGRRICAGMSLGLRMVQLLTATLVHAFDWDLPDGLMPEKLNM 257

HSP 2
Score: 191.224 bits (411), Expect = 3.2018e-49
Identity = 77/85 (90.59%), Postives = 78/85 (91.76%), Query Frame = -3
Query:  300 PCSVSQASIHQAGPNHMHELRLQLXVEPCVNLSSSQHIFYAQHQMVXLQXHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHEIWP 554
PCSVSQASIHQAGPN MHELR QL VEPCVNLSSSQH FYAQHQMV LQ HFP*YQHGPFRYPVGSVRA*TLMGWSIVLDH +WP
Sbjct: 2 PCSVSQASIHQAGPNQMHELR*QLIVEPCVNLSSSQHKFYAQHQMVWLQNHFP*YQHGPFRYPVGSVRA*TLMGWSIVLDHVLWP 256

HSP 3
Score: 189.849 bits (408), Expect = 8.3023e-49
Identity = 79/86 (91.86%), Postives = 81/86 (94.19%), Query Frame = 1
Query:  298 LGHIS*SKTMDQPIRV*ARTLPTG*RKGPC*Y*GK*X*SHTIWCWA*NMCWDELRFTHGSTXNCNLSSCI*LGPA*WIDA*ETEHG 555
LGH +*SKTMDQPIRV*ARTLPTG*RKGPC*Y GK* *SHTIWCWA*N+CWDELRFTHGST NC LSSCI*LGPA*WIDA*ETEHG
Sbjct: 1 LGHST*SKTMDQPIRV*ARTLPTG*RKGPC*YQGK*F*SHTIWCWA*NLCWDELRFTHGSTINCYLSSCI*LGPA*WIDA*ETEHG 258

HSP 4
Score: 186.642 bits (401), Expect = 7.66902e-48
Identity = 81/86 (94.19%), Postives = 81/86 (94.19%), Query Frame = -2
Query:  298 SMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQ 555
SMFSFSGINPSGRSQS A*TKVAV S*TMRKPKLIPA ILRPAPNGM SKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSR MAQ
Sbjct: 1 SMFSFSGINPSGRSQSNA*TKVAVNS*TMRKPKLIPAQILRPAPNGMASKSFPLISTWAFSLPGRKRSGLNSNGLVHCFGSRAMAQ 258

HSP 5
Score: 182.06 bits (391), Expect = 1.8369e-46
Identity = 78/85 (91.76%), Postives = 79/85 (92.94%), Query Frame = -1
Query:  299 HVQFLRHQSIRQVPIICMN*GCS**LNHA*T*AHPSTYSTPSTKWYXFKXISLNINMGLFATR*EAFGPKL*WVGPLFWITRYGP 553
HVQFLRHQSIRQVPI CMN*G S**LNHA*T*AHPST STPSTKWY FK ISL+INMGLFATR*EAFGPKL*WVGPLFWIT YGP
Sbjct: 3 HVQFLRHQSIRQVPIKCMN*GSS**LNHA*T*AHPSTNSTPSTKWYGFKIISLDINMGLFATR*EAFGPKL*WVGPLFWITCYGP 257

HSP 6
Score: 179.769 bits (386), Expect = 8.98996e-46
Identity = 77/85 (90.59%), Postives = 79/85 (92.94%), Query Frame = 3
Query:  300 GPYLVIQNNGPTH*SLGPNASYRVAKRPMLILREMXLKXYHLVLGVEYVLG*A*VYAWFNY*LQP*FMHMIGTCLMD*CLRN*TW 554
GP VIQNNGPTH*SLGPNASYRVAKRPMLI REM LK YHLVLGVE+VLG*A*VYAWFNY*L P*FMH+IGTCLMD*CLRN*TW
Sbjct: 2 GP*HVIQNNGPTH*SLGPNASYRVAKRPMLISREMILKPYHLVLGVEFVLG*A*VYAWFNY*LLP*FMHLIGTCLMD*CLRN*TW 256

AC454_contig2973_v23.35973e-5350.83%
AC454_contig2973_v2
HSP 1
Score: 156.858 bits (336), Expect = 3.35973e-53
Identity = 61/120 (50.83%), Postives = 86/120 (71.67%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
M G+DTS+ T+ W +A L+ + +L + Q ELD VGR+R+V E D+++L YLQA+VKET RL+P+ L+ PR E+C I GY +PKG+ L+ NVW I DP+ W++PLEF+PERFL
Sbjct: 222 MIAGGSDTSTVTLTWTIALLLNNRHVLKKAQDELDVQVGRERIVNESDISKLVYLQAIVKETLRLYPAGRLAGPREFTENCIIGGYXVPKGTRLITNVWKIQTDPRIWSDPLEFKPERFL 581

HSP 2
Score: 67.9658 bits (142), Expect = 3.35973e-53
Identity = 24/47 (51.06%), Postives = 35/47 (74.47%), Query Frame = 2
Query:  383 HVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
+VD++G +FE +PFG+GRR C G+S L+MVQL A+ +H YD +P
Sbjct: 594 NVDVRGQNFELLPFGSGRRACPGISFALQMVQLALASFLHMYDISIP 734

HSP 3
Score: 62.9255 bits (131), Expect = 1.20267e-20
Identity = 34/69 (49.28%), Postives = 36/69 (52.17%), Query Frame = -2
Query:  157 RKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VS 363
R SGLNSNG H GS + T PFG *P I Q S RG S G+ R VSLT AWR* S
Sbjct: 374 RNLSGLNSNGSDHMRGSV*IFHTFVINRVPFGTX*PPIMQFSVNSRGPASRPAGYKRNVSLTIAWR*TS 580

HSP 4
Score: 38.6404 bits (78), Expect = 1.20267e-20
Identity = 20/43 (46.51%), Postives = 25/43 (58.14%), Query Frame = -2
Query:  382 SYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPLISTW 510
SY K+A + T+ + K IP H L P PNG SK PL ST+
Sbjct: 593 SYMCRKLANANCTI*RAKDIPGHALLPLPNGSNSKF*PLTSTF 721

HSP 5
Score: 31.3091 bits (62), Expect = 1.20267e-20
Identity = 16/37 (43.24%), Postives = 22/37 (59.46%), Query Frame = -1
Query:   71 DHSLEVSELG*V*FTYEPVSAHNGVKLLLDLGQDLRV 181
++SLE+ L V*F Y AH +KL+L L Q + V
Sbjct: 288 NYSLEID*LTDV*FVYNSFPAHLDIKLILGLLQHMAV 398

AC454_contig18965_v22.15191e-5248.05%
AC454_contig18965_v2
HSP 1
Score: 97.7493 bits (207), Expect = 2.15191e-52
Identity = 37/77 (48.05%), Postives = 53/77 (68.83%), Query Frame = 2
Query:  389 DIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRL 619
D KG++FE IPFG+GRR C GM LGL + L A L+H + W+LPDG+ P +++M++ +GLT RA L+ P R+
Sbjct: 848 DYKGSNFEFIPFGSGRRSCPGMQLGLYALDLCVAHLLHCFTWELPDGMKPSEMDMNDVFGLTAPRAIRLVAVPTKRV 1078

HSP 2
Score: 87.6687 bits (185), Expect = 2.15191e-52
Identity = 38/69 (55.07%), Postives = 49/69 (71.01%), Query Frame = 2
Query:   17 GTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSL 223
GT+T +S +EWA+AEL++ P+ L +VQQEL VVG DR V E D +L YL+ +KET RLHP PL L
Sbjct: 488 GTETVASAIEWAMAELMKSPEDLKKVQQELADVVGLDRRVEEGDFDKLKYLKCCLKETLRLHPPIPLLL 694

HSP 3
Score: 55.1359 bits (114), Expect = 2.15191e-52
Identity = 19/43 (44.19%), Postives = 27/43 (62.79%), Query Frame = 2
Query:  236 AESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+E E+ GY+IP S +++N WAI RD W + F+P RFL
Sbjct: 704 SEDAEVAGYYIPAKSRVMINAWAIGRDNNSWEDAETFKPSRFL 832

HSP 4
Score: 47.3464 bits (97), Expect = 4.23896e-15
Identity = 26/60 (43.33%), Postives = 29/60 (48.33%), Query Frame = -2
Query:  394 VSPYASSMFSFSGINPSGRSQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPL 573
VSP S M G PSG S * + A + P IP H LRP PNG+ SK PL
Sbjct: 853 VSPNTSFMSISLGFIPSGNSHVKQ*RR*ATHKSSA*SPSCIPGHDLRPDPNGINSKLLPL 1032

HSP 5
Score: 33.1419 bits (66), Expect = 4.23896e-15
Identity = 15/28 (53.57%), Postives = 17/28 (60.71%), Query Frame = -2
Query:   16 CWTWARILGCRMSSAKAHSTVLDDVSVP 99
CWT+ R G +SSA AHS VSVP
Sbjct: 487 CWTFFRSSGLFISSAMAHSIADATVSVP 570

HSP 6
Score: 25.8106 bits (50), Expect = 4.23896e-15
Identity = 10/20 (50.00%), Postives = 13/20 (65.00%), Query Frame = -2
Query:  181 SAAMRGRESGVEGWSRKVSL 240
S+ + R SG+ GW R VSL
Sbjct: 652 SSDVSWRSSGIGGWRRSVSL 711

HSP 7
Score: 23.9778 bits (46), Expect = 4.23896e-15
Identity = 8/28 (28.57%), Postives = 13/28 (46.43%), Query Frame = -1
Query:  233 ITRYGPNID*KSGALWNVVAIDFTTFGC 316
++ P +D + WNVV + GC
Sbjct: 701 VSTNSPRVDHNA*LCWNVVTCHLSILGC 784

AC454_contig22743_v21.1018e-4851.26%
AC454_contig22743_v2
HSP 1
Score: 159.607 bits (342), Expect = 1.1018e-48
Identity = 61/119 (51.26%), Postives = 85/119 (71.43%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERF 361
+ AG DTSS+T+EWA++ L+ HP + +V+ E+D+ VG+ RL+ E DL +L YLQ V+ ET RL+P PL +PR A++ C + Y +P+G+ LLVN WAI RDPK W NP +F PERF
Sbjct: 571 LLVAGIDTSSTTLEWAMSLLLNHPTAMERVRAEIDANVGQGRLLDEQDLPKLHYLQNVISETLRLYPPVPLLVPREASKDCVVGNYDVPQGAMLLVNAWAIHRDPKVWVNPTKFMPERF 927

HSP 2
Score: 50.0956 bits (103), Expect = 1.1018e-48
Identity = 17/40 (42.50%), Postives = 27/40 (67.50%), Query Frame = 2
Query:  398 GNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWD 517
G + IPFGAGRR C G++L R++ L TL+ +++W+
Sbjct: 940 GEGYRLIPFGAGRRGCPGVALANRVIGLALGTLIQSFEWE 1059

HSP 3
Score: 49.6374 bits (102), Expect = 5.0052e-12
Identity = 31/80 (38.75%), Postives = 37/80 (46.25%), Query Frame = -2
Query:  154 ISTWAFSLPGRKRSGLNSNGLVHCFGSRDMAQTLTKRVEPFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSW 393
IS + L SG+N G GS MAQ LT + P G * +Q A RG G G+ R VSL T R* S+
Sbjct: 720 ISLYPSPLHPSNLSGINFVGFTQTLGSL*MAQALTNNIAP*GTS*LPTTQSLEASRGTRRGTGGYKRSVSLITFCR*CSF 959

HSP 4
Score: 27.1852 bits (53), Expect = 5.0052e-12
Identity = 11/24 (45.83%), Postives = 17/24 (70.83%), Query Frame = -2
Query:    7 LGCRMSSAKAHSTVLDDVSVPAVN 78
+G +S AHS V+D+VS+PA +
Sbjct: 573 VGWLSNSDIAHSKVVDEVSIPATS 644

HSP 5
Score: 26.2688 bits (51), Expect = 5.0052e-12
Identity = 16/41 (39.02%), Postives = 18/41 (43.90%), Query Frame = -2
Query:  394 SQSYA*TKVAVXS*TMRKPKLIPAHILRPAPNGMXSKSFPL 516
S S * KV + R P H L PAPNG+ PL
Sbjct: 936 SHSND*IKVPNANPITRLASATPGHPLLPAPNGISLYPSPL 1058

AC454_contig7495_v22.08265e-4842.86%
AC454_contig7495_v2
HSP 1
Score: 120.202 bits (256), Expect = 2.08265e-48
Identity = 45/105 (42.86%), Postives = 67/105 (63.81%), Query Frame = 2
Query:   59 ELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGS 373
ELIRHP+++ +VQ E+ + G + + E DL ++ YL+A++KET R HP PL R + + +I GY I G+ +++N W I +DP W P EF+PERFL S
Sbjct: 206 ELIRHPELMKKVQNEVREIXGNKKDITEXDLDKMHYLKAIIKETLRFHPPVPLLTLRKSIQDAKIHGYDIAAGTQVIINAWTIGKDPTLWDEPEEFQPERFLTSS 520

HSP 2
Score: 88.5852 bits (187), Expect = 2.08265e-48
Identity = 33/66 (50.00%), Postives = 47/66 (71.21%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQR 583
+D KG+DF+ IPFGAGRR C G+S + ++L+ A LV ++W LPDG + + LNM E+ GLT+ R
Sbjct: 8 IDFKGHDFQLIPFGAGRRGCPGISFAITTIELVLANLVRNFEWTLPDGAIGKDLNMTESTGLTIHR 205

AC454_contig7455_v23.87966e-4847.90%
AC454_contig7455_v2
HSP 1
Score: 151.36 bits (324), Expect = 3.87966e-48
Identity = 57/119 (47.90%), Postives = 84/119 (70.59%), Query Frame = 2
Query:    5 MFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERF 361
M AGT++SS+T+EWAL+ L++HP+ + + E+++ VG+ R + E DL +L YLQ V+ ET RL P +PL +P ++E C + G+H+ +G+ LLVN+W I RDPK W P FRPERF
Sbjct: 598 MLLAGTESSSTTMEWALSLLLKHPETMHKAWAEINTNVGQARFLEESDLTKLNYLQNVIDETLRLFPPSPLLIPHESSEECTVSGFHVGQGTMLLVNLWTIHRDPKLWVEPERFRPERF 954

HSP 2
Score: 56.5106 bits (117), Expect = 3.87966e-48
Identity = 19/44 (43.18%), Postives = 29/44 (65.91%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWD 517
V+ +GN ++ +PFG GRR C G +LG R+V L L+ ++WD
Sbjct: 961 VEAEGNRYQLLPFGVGRRACPGAALGRRVVGLALGALIQCFEWD 1092

Blast Hits to Contigs V2 ABall

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_ABall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Match Name E value Identity
ABall_contig3423_v21.09423e-4388.46%
ABall_contig3423_v2
HSP 1
Score: 114.245 bits (243), Expect = 1.09423e-43
Identity = 46/52 (88.46%), Postives = 49/52 (94.23%), Query Frame = 2
Query:  122 RDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKG 277
++R ELDLAQLTYLQAVVKETFRLHPSTPLSLPRMA+ESCEIDGYHIPKG
Sbjct: 405 KNRFXSELDLAQLTYLQAVVKETFRLHPSTPLSLPRMASESCEIDGYHIPKG 560

HSP 2
Score: 64.3001 bits (134), Expect = 1.09423e-43
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 2
Query:   38 TVEWALAELIRHPKILAQVQQELDSVVGR 124
+VEWA+AELIRHPKILAQVQ+ELDSVVGR
Sbjct: 319 SVEWAIAELIRHPKILAQVQKELDSVVGR 405

HSP 3
Score: 30.3927 bits (60), Expect = 1.09423e-43
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    2 NMFTAGTDTSSS 37
NMFTAGTDTSSS
Sbjct: 284 NMFTAGTDTSSS 319

HSP 4
Score: 99.5822 bits (211), Expect = 9.36113e-35
Identity = 42/51 (82.35%), Postives = 43/51 (84.31%), Query Frame = -1
Query:  125 ALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPV 277
A NVV +DFTTFGCHAWQRE G*RVEPEGFLDH LEVSELG*V F YE V
Sbjct: 408 AFRNVVPVDFTTFGCHAWQRERG*RVEPEGFLDHXLEVSELG*VQFAYEXV 560

HSP 5
Score: 49.1792 bits (101), Expect = 9.36113e-35
Identity = 18/19 (94.74%), Postives = 18/19 (94.74%), Query Frame = -2
Query:   40 WTWARILGCRMSSAKAHST 96
WTWARILGCRMSSA AHST
Sbjct: 321 WTWARILGCRMSSAMAHST 377

HSP 6
Score: 29.9345 bits (59), Expect = 9.36113e-35
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = -2
Query:    1 LDDVSVPAVNIF 36
LDDVSVPAVNIF
Sbjct: 283 LDDVSVPAVNIF 318

HSP 7
Score: 96.8329 bits (205), Expect = 2.37943e-34
Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:  126 TGS*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQR 275
T S* N T*PNSLTSR WSRKPSGSTLQP SLCHAW PKVVKS TTF++
Sbjct: 409 TXS*ANWT*PNSLTSRXWSRKPSGSTLQPRSLCHAWHPKVVKSTGTTFRK 558

HSP 8
Score: 50.5539 bits (104), Expect = 2.37943e-34
Identity = 21/30 (70.00%), Postives = 22/30 (73.33%), Query Frame = 3
Query:   36 AQWNGP*PNSSGTLRSWPKSNKSLTPLWAE 125
+Q NGP*PNSS R WPKS KSLT LW E
Sbjct: 317 SQ*NGP*PNSSDIPRFWPKSKKSLTRLWVE 406

HSP 9
Score: 29.9345 bits (59), Expect = 2.37943e-34
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 1
Query:    1 EYVHGRH*HVI 33
EYVHGRH*H+I
Sbjct: 283 EYVHGRH*HII 315

HSP 10
Score: 98.6658 bits (209), Expect = 7.26512e-33
Identity = 39/48 (81.25%), Postives = 41/48 (85.42%), Query Frame = -3
Query:  126 ECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLRAG 269
ECG+ RFHNFR+PCVAER GLKGGAGRFP*P PGGK*VGLG I L G
Sbjct: 409 ECGTRRFHNFRMPCVAERAGLKGGAGRFP*PXPGGK*VGLGPIRLXXG 552

HSP 11
Score: 47.3464 bits (97), Expect = 7.26512e-33
Identity = 19/28 (67.86%), Postives = 22/28 (78.57%), Query Frame = -1
Query:   41 SAHNGVKLLLDLGQDLRVPDEFG*GPFH 124
S HN VKL LDLGQ+L + DEFG GPF+
Sbjct: 322 STHNRVKLFLDLGQNLGMSDEFGYGPFY 405

HSP 12
Score: 26.2688 bits (51), Expect = 7.26512e-33
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = -3
Query:    3 MTCQCLP*TY 32
M CQCLP*TY
Sbjct: 285 MMCQCLP*TY 314

HSP 13
Score: 85.3777 bits (180), Expect = 1.77399e-27
Identity = 33/39 (84.62%), Postives = 35/39 (89.74%), Query Frame = 1
Query:  157 THLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSK 273
THLPPG GQGNLPAPPFNP LSATHG RKL*NR +PHS+
Sbjct: 440 THLPPGXGQGNLPAPPFNPALSATHGIRKL*NRRVPHSE 556

HSP 14
Score: 43.6807 bits (89), Expect = 1.77399e-27
Identity = 19/27 (70.37%), Postives = 19/27 (70.37%), Query Frame = 1
Query:   40 SGMGLSRTHPAP*DPGPSPTRA*LRCG 120
S MG SRTHP D GPSP RA*L CG
Sbjct: 321 SRMGHSRTHPTSQDSGPSPKRA*LGCG 401

HSP 15
Score: 24.8942 bits (48), Expect = 1.77399e-27
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:    3 ICSRQALTRH 32
ICSRQALT H
Sbjct: 285 ICSRQALTHH 314

HSP 16
Score: 97.7493 bits (207), Expect = 9.57797e-23
Identity = 40/42 (95.24%), Postives = 40/42 (95.24%), Query Frame = -2
Query:  151 PFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 276
PFGMW PSISQLS AMRGRESGVEGWSRKVSLTTAWR*VSWA
Sbjct: 434 PFGMWYPSISQLSDAMRGRESGVEGWSRKVSLTTAWR*VSWA 559

HSP 17
Score: 22.6031 bits (43), Expect = 9.57797e-23
Identity = 8/8 (100.00%), Postives = 8/8 (100.00%), Query Frame = -1
Query:    2 VSACREHI 25
VSACREHI
Sbjct: 284 VSACREHI 307

ABall_contig7641_v22.49852e-4155.67%
ABall_contig7641_v2
HSP 1
Score: 133.031 bits (284), Expect = 2.49852e-41
Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 2
Query:   89 QVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEK 379
+V +EL+ VVG D LV E L +L YL AV+KETFRLHP P +PR ++S I Y++PKG+ +L+NVW I RDPK W NPLEF+PERFL K
Sbjct: 40 KVNEELEEVVGLDSLVEESHLPKLHYLDAVIKETFRLHPPLPFLVPRSPSQSSTIGEYYVPKGTQVLLNVWVIHRDPKLWENPLEFQPERFLNDPSK 330

HSP 2
Score: 45.9718 bits (94), Expect = 2.49852e-41
Identity = 16/30 (53.33%), Postives = 24/30 (80.00%), Query Frame = 2
Query:  371 SEKAHVDIKGNDFEXIPFGAGRRICAGMSL 460
++ + +D GN+F+ IPFG+GRRICAG+ L
Sbjct: 316 NDPSKLDYSGNNFKYIPFGSGRRICAGIPL 405

HSP 3
Score: 22.1449 bits (42), Expect = 2.49852e-41
Identity = 6/15 (40.00%), Postives = 13/15 (86.67%), Query Frame = 2
Query:   53 LAELIRHPKILAQVQ 97
+AEL++HP+++ + Q
Sbjct: 3 MAELLQHPEVMRKSQ 47

ABall_contig8281_v29.25009e-4056.52%
ABall_contig8281_v2
HSP 1
Score: 89.9598 bits (190), Expect = 9.25009e-40
Identity = 39/69 (56.52%), Postives = 49/69 (71.01%), Query Frame = 2
Query:   17 GTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSL 223
GT+T +S +EWA+AEL+R P+ L +VQQEL VVG DR V E D +L YL+ +KET RLHP PL L
Sbjct: 247 GTETVASAIEWAMAELMRSPEDLKKVQQELAEVVGLDRRVEESDFDKLKYLKCCLKETLRLHPPIPLLL 453

HSP 2
Score: 57.427 bits (119), Expect = 9.25009e-40
Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 2
Query:  236 AESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+E E+ GYHIP S +++N +AI RD W P F+P RFL
Sbjct: 463 SEDAEVSGYHIPAKSRVMINAFAIGRDSNSWDEPDTFKPSRFL 591

HSP 3
Score: 48.2628 bits (99), Expect = 9.25009e-40
Identity = 18/26 (69.23%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  389 DIKGNDFEXIPFGAGRRICAGMSLGL 466
D KG +FE IPFG+GRR C GM LGL
Sbjct: 607 DFKGGNFEFIPFGSGRRSCPGMQLGL 684

ABall_contig2268_v22.79493e-3656.98%
ABall_contig2268_v2
HSP 1
Score: 127.075 bits (271), Expect = 2.79493e-36
Identity = 49/86 (56.98%), Postives = 63/86 (73.26%), Query Frame = 2
Query:  107 DSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
D V+G +R++ E D + L YLQ+V KE+ RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NPLE+RPERFL
Sbjct: 3 DRVIGLERVMTEADFSNLPYLQSVAKESLRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAIWKNPLEYRPERFL 260

HSP 2
Score: 38.6404 bits (78), Expect = 2.79493e-36
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRI 442
VD+KG+DF +PFGAGRR+
Sbjct: 270 VDMKGHDFRLLPFGAGRRV 326

ABall_contig5043_v25.86863e-3250.00%
ABall_contig5043_v2
HSP 1
Score: 131.657 bits (281), Expect = 5.86863e-32
Identity = 52/104 (50.00%), Postives = 71/104 (68.27%), Query Frame = 2
Query:   50 ALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERF 361
A+AEL+R PK L + +QE+ V+G + E D+ +L YL A+VKET RLHP PL LP +A ++ GY I KG+ +L+N W+I R+PK WT+PL F PERF
Sbjct: 1 AMAELLRKPKTLQKARQEVLDVIGPQGEIKESDIDRLPYLXAIVKETLRLHPXXPLLLPYIAGNDVQVSGYTIHKGNQVLINAWSIGRNPKYWTDPLSFEPERF 312

ABall_contig2875_v23.6449e-3051.11%
ABall_contig2875_v2
HSP 1
Score: 125.7 bits (268), Expect = 3.6449e-30
Identity = 46/90 (51.11%), Postives = 65/90 (72.22%), Query Frame = 2
Query:   95 QQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
Q+E+D VG+D+ V E D+ L YLQA+VKET RLHP P++ R A E C + GY++PKG+ ++VN+ + RDP+ W NP EF+PERF+
Sbjct: 4 QEEIDIQVGKDKXVEESDIKNLNYLQAIVKETLRLHPPGPITGVREAMEDCNVGGYYVPKGTQVIVNILKLQRDPRVWPNPYEFQPERFM 273

ABall_contig3908_v21.02069e-1858.70%
ABall_contig3908_v2
HSP 1
Score: 69.7986 bits (146), Expect = 1.02069e-18
Identity = 27/46 (58.70%), Postives = 33/46 (71.74%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
+D KG DFE IPFGAGRRIC G+ L RMV L+ A+LV+ + W P
Sbjct: 90 IDFKGQDFELIPFGAGRRICPGLPLANRMVHLILASLVYYFAWKPP 227

HSP 2
Score: 36.3494 bits (73), Expect = 1.02069e-18
Identity = 15/26 (57.69%), Postives = 16/26 (61.54%), Query Frame = 2
Query:  287 LVNVWAISRDPKQWTNPLEFRPERFL 364
LV VWA+ D W NP F PERFL
Sbjct: 3 LVFVWAMGCDSSIWPNPNLFMPERFL 80

ABall_contig2380_v28.73642e-1746.88%
ABall_contig2380_v2
HSP 1
Score: 81.2538 bits (171), Expect = 8.73642e-17
Identity = 30/64 (46.88%), Postives = 48/64 (75.00%), Query Frame = 2
Query:    8 FTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRL 199
TAGTDTS+ T+EWA+A L+ H +L + + E+D +G++RL+ E D+++L YLQ+++ ET RL
Sbjct: 3 LTAGTDTSAVTLEWAMANLLNHSNVLKKARVEMDHQIGQERLMHESDVSKLHYLQSIISETLRL 194

ABall_contig2877_v23.05213e-1641.86%
ABall_contig2877_v2
HSP 1
Score: 49.1792 bits (101), Expect = 3.05213e-16
Identity = 18/43 (41.86%), Postives = 25/43 (58.14%), Query Frame = 2
Query:  263 HIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVD 391
+IP S +LVN W ++ +P W +P FRPERFL K +
Sbjct: 385 YIPAESKILVNAWWLANNPANWKDPEVFRPERFLEEESKVEAN 513

HSP 2
Score: 49.1792 bits (101), Expect = 3.05213e-16
Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 2
Query:  374 EKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDG 529
E++ V+ GNDF +PFG GRR C G+ L L ++ + LV ++ P G
Sbjct: 253 EESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPG 408

Blast Hits to Contigs V2 AB454

Analysis Date: 11-18-2009 (Blast: RO454_contigs_v2_vs_AB454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Match Name E value Identity
AB454_contig3350_v21.07363e-4388.46%
AB454_contig3350_v2
HSP 1
Score: 114.245 bits (243), Expect = 1.07363e-43
Identity = 46/52 (88.46%), Postives = 49/52 (94.23%), Query Frame = 2
Query:  122 RDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKG 277
++R ELDLAQLTYLQAVVKETFRLHPSTPLSLPRMA+ESCEIDGYHIPKG
Sbjct: 405 KNRFXSELDLAQLTYLQAVVKETFRLHPSTPLSLPRMASESCEIDGYHIPKG 560

HSP 2
Score: 64.3001 bits (134), Expect = 1.07363e-43
Identity = 26/29 (89.66%), Postives = 29/29 (100.00%), Query Frame = 2
Query:   38 TVEWALAELIRHPKILAQVQQELDSVVGR 124
+VEWA+AELIRHPKILAQVQ+ELDSVVGR
Sbjct: 319 SVEWAIAELIRHPKILAQVQKELDSVVGR 405

HSP 3
Score: 30.3927 bits (60), Expect = 1.07363e-43
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = 2
Query:    2 NMFTAGTDTSSS 37
NMFTAGTDTSSS
Sbjct: 284 NMFTAGTDTSSS 319

HSP 4
Score: 99.5822 bits (211), Expect = 9.18491e-35
Identity = 42/51 (82.35%), Postives = 43/51 (84.31%), Query Frame = -1
Query:  125 ALWNVVAIDFTTFGCHAWQREWG*RVEPEGFLDHSLEVSELG*V*FTYEPV 277
A NVV +DFTTFGCHAWQRE G*RVEPEGFLDH LEVSELG*V F YE V
Sbjct: 408 AFRNVVPVDFTTFGCHAWQRERG*RVEPEGFLDHXLEVSELG*VQFAYEXV 560

HSP 5
Score: 49.1792 bits (101), Expect = 9.18491e-35
Identity = 18/19 (94.74%), Postives = 18/19 (94.74%), Query Frame = -2
Query:   40 WTWARILGCRMSSAKAHST 96
WTWARILGCRMSSA AHST
Sbjct: 321 WTWARILGCRMSSAMAHST 377

HSP 6
Score: 29.9345 bits (59), Expect = 9.18491e-35
Identity = 12/12 (100.00%), Postives = 12/12 (100.00%), Query Frame = -2
Query:    1 LDDVSVPAVNIF 36
LDDVSVPAVNIF
Sbjct: 283 LDDVSVPAVNIF 318

HSP 7
Score: 96.8329 bits (205), Expect = 2.33464e-34
Identity = 40/50 (80.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query:  126 TGS*VN*T*PNSLTSRLWSRKPSGSTLQPHSLCHAWQPKVVKSMATTFQR 275
T S* N T*PNSLTSR WSRKPSGSTLQP SLCHAW PKVVKS TTF++
Sbjct: 409 TXS*ANWT*PNSLTSRXWSRKPSGSTLQPRSLCHAWHPKVVKSTGTTFRK 558

HSP 8
Score: 50.5539 bits (104), Expect = 2.33464e-34
Identity = 21/30 (70.00%), Postives = 22/30 (73.33%), Query Frame = 3
Query:   36 AQWNGP*PNSSGTLRSWPKSNKSLTPLWAE 125
+Q NGP*PNSS R WPKS KSLT LW E
Sbjct: 317 SQ*NGP*PNSSDIPRFWPKSKKSLTRLWVE 406

HSP 9
Score: 29.9345 bits (59), Expect = 2.33464e-34
Identity = 10/11 (90.91%), Postives = 11/11 (100.00%), Query Frame = 1
Query:    1 EYVHGRH*HVI 33
EYVHGRH*H+I
Sbjct: 283 EYVHGRH*HII 315

HSP 10
Score: 98.6658 bits (209), Expect = 7.12836e-33
Identity = 39/48 (81.25%), Postives = 41/48 (85.42%), Query Frame = -3
Query:  126 ECGSHRFHNFRLPCVAERVGLKGGAGRFP*PQPGGK*VGLGLIHLRAG 269
ECG+ RFHNFR+PCVAER GLKGGAGRFP*P PGGK*VGLG I L G
Sbjct: 409 ECGTRRFHNFRMPCVAERAGLKGGAGRFP*PXPGGK*VGLGPIRLXXG 552

HSP 11
Score: 47.3464 bits (97), Expect = 7.12836e-33
Identity = 19/28 (67.86%), Postives = 22/28 (78.57%), Query Frame = -1
Query:   41 SAHNGVKLLLDLGQDLRVPDEFG*GPFH 124
S HN VKL LDLGQ+L + DEFG GPF+
Sbjct: 322 STHNRVKLFLDLGQNLGMSDEFGYGPFY 405

HSP 12
Score: 26.2688 bits (51), Expect = 7.12836e-33
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = -3
Query:    3 MTCQCLP*TY 32
M CQCLP*TY
Sbjct: 285 MMCQCLP*TY 314

HSP 13
Score: 85.3777 bits (180), Expect = 1.7406e-27
Identity = 33/39 (84.62%), Postives = 35/39 (89.74%), Query Frame = 1
Query:  157 THLPPGCGQGNLPAPPFNPTLSATHGSRKL*NRWLPHSK 273
THLPPG GQGNLPAPPFNP LSATHG RKL*NR +PHS+
Sbjct: 440 THLPPGXGQGNLPAPPFNPALSATHGIRKL*NRRVPHSE 556

HSP 14
Score: 43.6807 bits (89), Expect = 1.7406e-27
Identity = 19/27 (70.37%), Postives = 19/27 (70.37%), Query Frame = 1
Query:   40 SGMGLSRTHPAP*DPGPSPTRA*LRCG 120
S MG SRTHP D GPSP RA*L CG
Sbjct: 321 SRMGHSRTHPTSQDSGPSPKRA*LGCG 401

HSP 15
Score: 24.8942 bits (48), Expect = 1.7406e-27
Identity = 9/10 (90.00%), Postives = 9/10 (90.00%), Query Frame = 3
Query:    3 ICSRQALTRH 32
ICSRQALT H
Sbjct: 285 ICSRQALTHH 314

HSP 16
Score: 97.7493 bits (207), Expect = 9.39767e-23
Identity = 40/42 (95.24%), Postives = 40/42 (95.24%), Query Frame = -2
Query:  151 PFGMW*PSISQLSAAMRGRESGVEGWSRKVSLTTAWR*VSWA 276
PFGMW PSISQLS AMRGRESGVEGWSRKVSLTTAWR*VSWA
Sbjct: 434 PFGMWYPSISQLSDAMRGRESGVEGWSRKVSLTTAWR*VSWA 559

HSP 17
Score: 22.6031 bits (43), Expect = 9.39767e-23
Identity = 8/8 (100.00%), Postives = 8/8 (100.00%), Query Frame = -1
Query:    2 VSACREHI 25
VSACREHI
Sbjct: 284 VSACREHI 307

AB454_contig7529_v22.45148e-4155.67%
AB454_contig7529_v2
HSP 1
Score: 133.031 bits (284), Expect = 2.45148e-41
Identity = 54/97 (55.67%), Postives = 68/97 (70.10%), Query Frame = 2
Query:   89 QVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEK 379
+V +EL+ VVG D LV E L +L YL AV+KETFRLHP P +PR ++S I Y++PKG+ +L+NVW I RDPK W NPLEF+PERFL K
Sbjct: 40 KVNEELEEVVGLDSLVEESHLPKLHYLDAVIKETFRLHPPLPFLVPRSPSQSSTIGEYYVPKGTQVLLNVWVIHRDPKLWENPLEFQPERFLNDPSK 330

HSP 2
Score: 45.9718 bits (94), Expect = 2.45148e-41
Identity = 16/30 (53.33%), Postives = 24/30 (80.00%), Query Frame = 2
Query:  371 SEKAHVDIKGNDFEXIPFGAGRRICAGMSL 460
++ + +D GN+F+ IPFG+GRRICAG+ L
Sbjct: 316 NDPSKLDYSGNNFKYIPFGSGRRICAGIPL 405

HSP 3
Score: 22.1449 bits (42), Expect = 2.45148e-41
Identity = 6/15 (40.00%), Postives = 13/15 (86.67%), Query Frame = 2
Query:   53 LAELIRHPKILAQVQ 97
+AEL++HP+++ + Q
Sbjct: 3 MAELLQHPEVMRKSQ 47

AB454_contig8184_v29.07597e-4056.52%
AB454_contig8184_v2
HSP 1
Score: 89.9598 bits (190), Expect = 9.07597e-40
Identity = 39/69 (56.52%), Postives = 49/69 (71.01%), Query Frame = 2
Query:   17 GTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSL 223
GT+T +S +EWA+AEL+R P+ L +VQQEL VVG DR V E D +L YL+ +KET RLHP PL L
Sbjct: 247 GTETVASAIEWAMAELMRSPEDLKKVQQELAEVVGLDRRVEESDFDKLKYLKCCLKETLRLHPPIPLLL 453

HSP 2
Score: 57.427 bits (119), Expect = 9.07597e-40
Identity = 20/43 (46.51%), Postives = 27/43 (62.79%), Query Frame = 2
Query:  236 AESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
+E E+ GYHIP S +++N +AI RD W P F+P RFL
Sbjct: 463 SEDAEVSGYHIPAKSRVMINAFAIGRDSNSWDEPDTFKPSRFL 591

HSP 3
Score: 48.2628 bits (99), Expect = 9.07597e-40
Identity = 18/26 (69.23%), Postives = 20/26 (76.92%), Query Frame = 2
Query:  389 DIKGNDFEXIPFGAGRRICAGMSLGL 466
D KG +FE IPFG+GRR C GM LGL
Sbjct: 607 DFKGGNFEFIPFGSGRRSCPGMQLGL 684

AB454_contig2193_v22.74231e-3656.98%
AB454_contig2193_v2
HSP 1
Score: 127.075 bits (271), Expect = 2.74231e-36
Identity = 49/86 (56.98%), Postives = 63/86 (73.26%), Query Frame = 2
Query:  107 DSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
D V+G +R++ E D + L YLQ+V KE+ RLHP TPL LP A + ++ GY IPKGS + VNVWA++RDP W NPLE+RPERFL
Sbjct: 3 DRVIGLERVMTEADFSNLPYLQSVAKESLRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAIWKNPLEYRPERFL 260

HSP 2
Score: 38.6404 bits (78), Expect = 2.74231e-36
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRI 442
VD+KG+DF +PFGAGRR+
Sbjct: 270 VDMKGHDFRLLPFGAGRRV 326

AB454_contig4954_v25.75816e-3250.00%
AB454_contig4954_v2
HSP 1
Score: 131.657 bits (281), Expect = 5.75816e-32
Identity = 52/104 (50.00%), Postives = 71/104 (68.27%), Query Frame = 2
Query:   50 ALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERF 361
A+AEL+R PK L + +QE+ V+G + E D+ +L YL A+VKET RLHP PL LP +A ++ GY I KG+ +L+N W+I R+PK WT+PL F PERF
Sbjct: 1 AMAELLRKPKTLQKARQEVLDVIGPQGEIKESDIDRLPYLXAIVKETLRLHPXXPLLLPYIAGNDVQVSGYTIHKGNQVLINAWSIGRNPKYWTDPLSFEPERF 312

AB454_contig2806_v23.57629e-3051.11%
AB454_contig2806_v2
HSP 1
Score: 125.7 bits (268), Expect = 3.57629e-30
Identity = 46/90 (51.11%), Postives = 65/90 (72.22%), Query Frame = 2
Query:   95 QQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFL 364
Q+E+D VG+D+ V E D+ L YLQA+VKET RLHP P++ R A E C + GY++PKG+ ++VN+ + RDP+ W NP EF+PERF+
Sbjct: 4 QEEIDIQVGKDKXVEESDIKNLNYLQAIVKETLRLHPPGPITGVREAMEDCNVGGYYVPKGTQVIVNILKLQRDPRVWPNPYEFQPERFM 273

AB454_contig3829_v21.00148e-1858.70%
AB454_contig3829_v2
HSP 1
Score: 69.7986 bits (146), Expect = 1.00148e-18
Identity = 27/46 (58.70%), Postives = 33/46 (71.74%), Query Frame = 2
Query:  386 VDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLP 523
+D KG DFE IPFGAGRRIC G+ L RMV L+ A+LV+ + W P
Sbjct: 90 IDFKGQDFELIPFGAGRRICPGLPLANRMVHLILASLVYYFAWKPP 227

HSP 2
Score: 36.3494 bits (73), Expect = 1.00148e-18
Identity = 15/26 (57.69%), Postives = 16/26 (61.54%), Query Frame = 2
Query:  287 LVNVWAISRDPKQWTNPLEFRPERFL 364
LV VWA+ D W NP F PERFL
Sbjct: 3 LVFVWAMGCDSSIWPNPNLFMPERFL 80

AB454_contig2305_v28.57197e-1746.88%
AB454_contig2305_v2
HSP 1
Score: 81.2538 bits (171), Expect = 8.57197e-17
Identity = 30/64 (46.88%), Postives = 48/64 (75.00%), Query Frame = 2
Query:    8 FTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRL 199
TAGTDTS+ T+EWA+A L+ H +L + + E+D +G++RL+ E D+++L YLQ+++ ET RL
Sbjct: 3 LTAGTDTSAVTLEWAMANLLNHSNVLKKARVEMDHQIGQERLMHESDVSKLHYLQSIISETLRL 194

AB454_contig7560_v21.60694e-1640.91%
AB454_contig7560_v2
HSP 1
Score: 50.0956 bits (103), Expect = 1.60694e-16
Identity = 18/44 (40.91%), Postives = 26/44 (59.09%), Query Frame = 2
Query:  260 YHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVD 391
++IP S +LVN W ++ +P W +P FRPERFL K +
Sbjct: 74 WYIPAESKILVNAWWLANNPANWKDPEVFRPERFLEEESKVEAN 205

HSP 2
Score: 49.1792 bits (101), Expect = 1.60694e-16
Identity = 20/52 (38.46%), Postives = 30/52 (57.69%), Query Frame = 2
Query:  374 EKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDG 529
E++ V+ GNDF +PFG GRR C G+ L L ++ + LV ++ P G
Sbjct: 182 EESKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPG 337

Blast Hits to Uniprot

Analysis Date: 11-18-2009 (Blast: RO454_v2_uniprot)
Best 10 Hits Shown | Show Best 25 Hits | Show All Hits
Note: Click a description for more details.
Match Name E value Identity
B9I6R6_POPTR4.64977e-10588.68%
Flavonoid 3'-hydroxylase OS=Populus trichocarpa GN=F3H1 PE=3 SV=1
HSP 1
Score: 384.03 bits (985), Expect = 4.64977e-105
Identity = 188/212 (88.68%), Postives = 198/212 (93.40%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYR 637
NMFTAGTDTSSSTVEWA+AELIRHP ILAQV+QELDSVVGRDRLV ELDLAQLTYLQAVVKETFRLHPSTPLSLPR+AAESCEI GYHIPKGST+LVNVWAI+RDP WT PLEFRPERFLPG +KA VD+KGNDFE IPFGAGRRICAGMSLGLRMVQLLTATL+HA+DWDL DGL+PEKLNMDEAYGLTLQRA PLMVHP PRLS VYR
Sbjct: 307 NMFTAGTDTSSSTVEWAIAELIRHPDILAQVKQELDSVVGRDRLVTELDLAQLTYLQAVVKETFRLHPSTPLSLPRIAAESCEIGGYHIPKGSTVLVNVWAIARDPDVWTKPLEFRPERFLPGGDKADVDVKGNDFELIPFGAGRRICAGMSLGLRMVQLLTATLIHAFDWDLADGLVPEKLNMDEAYGLTLQRADPLMVHPRPRLSPKVYR 518

C5IGQ4_MALDO2.38805e-10182.79%
Flavonoid 3' hydroxylase IIa OS=Malus domestica PE=4 SV=1
HSP 1
Score: 371.703 bits (953), Expect = 2.38805e-101
Identity = 178/215 (82.79%), Postives = 194/215 (90.23%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
NMFTAGTDTSSSTVEWA+AEL+RHPKILAQ+QQELD V GRDRL+ E DL LTYLQAV+KETFRLHPSTPLSLPRMA+ESCEI+G+HIPKG+TLLVNVWAISRDP QW+ PLEFRPERFLPG EK +VD+KGNDFE IPFGAGRRICAGM+LGLRMV L+TATLVH +DW L DGL PEKLNMDEAYGLTLQRAAPLMVHP RL+ H Y ASS
Sbjct: 296 NMFTAGTDTSSSTVEWAIAELLRHPKILAQLQQELDQVAGRDRLITESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGMTLGLRMVSLMTATLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAYNASS 510

C5IGQ5_MALDO3.11889e-10183.26%
Flavonoid 3' hydroxylase IIb OS=Malus domestica PE=4 SV=1
HSP 1
Score: 371.318 bits (952), Expect = 3.11889e-101
Identity = 179/215 (83.26%), Postives = 194/215 (90.23%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
NMFTAGTDTSSSTVEWA+AEL+RHPKILAQ+QQELD VVGRDRLV E DL LTYLQAV+KETFRLHPSTPLSLPRMA+ESCEI+G+HIPKG+TLLVNVWAISRDP QW+ PLEFRPERFLPG EK +VD+KGNDFE IPFGAGRRICAGM+LGLRMV L+ ATLVH +DW L DGL PEKLNMDEAYGLTLQRAAPLMVHP RL+ H Y ASS
Sbjct: 296 NMFTAGTDTSSSTVEWAIAELLRHPKILAQLQQELDQVVGRDRLVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMASESCEINGFHIPKGATLLVNVWAISRDPAQWSEPLEFRPERFLPGGEKPNVDVKGNDFEVIPFGAGRRICAGMTLGLRMVSLMIATLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAYNASS 510

C5IGQ3_MALDO1.18518e-10082.79%
Flavonoid 3' hydroxylase OS=Malus domestica PE=4 SV=1
HSP 1
Score: 369.392 bits (947), Expect = 1.18518e-100
Identity = 178/215 (82.79%), Postives = 193/215 (89.77%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
NMFTAGTDTSSSTVEWA+AEL+RHPKILAQ+QQELD VVGRDRLV E DL LTYLQAV+KETFRLHPSTPLSLPRMA ESCEI+G+HIPKG+TLLVNVWA+SRDP QW+ PLEFRPERF+ G EK +VDI+GNDFE IPFGAGRRICAGMSLGLRMV L+TATLVH +DW L DGL PEKLNMDEAYGLTLQRAAPLMVHP RL+ H Y ASS
Sbjct: 296 NMFTAGTDTSSSTVEWAIAELLRHPKILAQLQQELDQVVGRDRLVTESDLPNLTYLQAVIKETFRLHPSTPLSLPRMATESCEINGFHIPKGATLLVNVWAVSRDPDQWSEPLEFRPERFMSGGEKPNVDIRGNDFEVIPFGAGRRICAGMSLGLRMVSLMTATLVHGFDWTLADGLTPEKLNMDEAYGLTLQRAAPLMVHPRNRLAPHAYNASS 510

A4F1U3_LOBER8.49355e-9981.22%
Flavonoid 3'-hydroxylase OS=Lobelia erinus GN=LeF3'H PE=2 SV=1
HSP 1
Score: 363.229 bits (931), Expect = 8.49355e-99
Identity = 173/213 (81.22%), Postives = 192/213 (90.14%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRA 640
NMF AGTDTSSSTVEWALAELIRHPKILAQ QQELD VVGRDRLV E DL+QLT+ QA++KETFRLHPSTPLSLPRMAAESCEI+GY IPKGST+LVNVWAI+RDP W PLEFRP+RFLPG EKA+VD+KGNDFE IPFGAGRR+CAG+SLGLRMVQL+TATLVH++DW+L DG PE+LNM+E YGLTLQRA PL VHP PRLS HVY+A
Sbjct: 303 NMFIAGTDTSSSTVEWALAELIRHPKILAQAQQELDEVVGRDRLVSESDLSQLTFFQAIIKETFRLHPSTPLSLPRMAAESCEINGYFIPKGSTVLVNVWAIARDPDIWAEPLEFRPQRFLPGGEKANVDVKGNDFEVIPFGAGRRVCAGLSLGLRMVQLVTATLVHSFDWELADGQKPEELNMEEGYGLTLQRAKPLKVHPRPRLSEHVYQA 515

B9UZ52_9ROSI3.22755e-9880.00%
Flavonoid 3'-hydroxylase OS=Garcinia mangostana GN=F3'H PE=2 SV=1
HSP 1
Score: 361.303 bits (926), Expect = 3.22755e-98
Identity = 172/215 (80.00%), Postives = 191/215 (88.84%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRASS 646
N FTAGTDTSSSTVEWA+AEL+RHPKIL QVQ+ELDSVVGRDRLV +LDL QLTYL AV+KETFRLHPSTPLSLPRMAAESCEIDGYHIPKG+TLLVNVWAI+RDP W PL F PERFLPG EKA VD++GNDFE IPFG GRRICAG+S GLR+V L+ ATL+HA+DW+L +GL+PEKLNMDEAYGLTLQRAAPLMVHP PRLS Y+A +
Sbjct: 293 NFFTAGTDTSSSTVEWAIAELLRHPKILTQVQRELDSVVGRDRLVSDLDLPQLTYLSAVIKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGATLLVNVWAIARDPDVWAEPLVFMPERFLPGGEKAKVDVRGNDFELIPFGGGRRICAGLSYGLRVVYLMAATLLHAFDWELANGLIPEKLNMDEAYGLTLQRAAPLMVHPKPRLSPQAYKAKN 507

Q9FPN5_CALCH9.39072e-9880.28%
Putative flavonoid 3'-hydroxylase OS=Callistephus chinensis PE=2 SV=1
HSP 1
Score: 359.762 bits (922), Expect = 9.39072e-98
Identity = 171/213 (80.28%), Postives = 192/213 (90.14%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRA 640
N+F AGTDTSSSTVEWA+AELIRHP++L Q ++E+D VVGRDRLV ELDL++LT+LQA+VKETFRLHPSTPLSLPRMA+ESCE+DGY+IPKGSTLLVNVWAI+RDPK WTNPLEFRP RFLPG EK DIKGNDFE IPFGAGRRICAGMSLG+RMVQLL ATLV +DW+L +GL PEKLNM+EAYGLTLQRA PLMVHP PRLS HVY +
Sbjct: 305 NLFAAGTDTSSSTVEWAVAELIRHPELLKQAREEMDIVVGRDRLVTELDLSRLTFLQAIVKETFRLHPSTPLSLPRMASESCEVDGYYIPKGSTLLVNVWAIARDPKMWTNPLEFRPSRFLPGGEKPDADIKGNDFEVIPFGAGRRICAGMSLGMRMVQLLIATLVQTFDWELANGLDPEKLNMEEAYGLTLQRAEPLMVHPRPRLSPHVYES 517

Q3C212_VITVI4.66057e-9780.09%
Flavonoid 3'-hydroxylase OS=Vitis vinifera GN=VvF3'h3 PE=3 SV=1
HSP 1
Score: 357.451 bits (916), Expect = 4.66057e-97
Identity = 169/211 (80.09%), Postives = 192/211 (91.00%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
N+FTAGTDTSSSTVEWA+AELIRHP+++AQ QQELD+VVGR RLV +LDL QLTYLQA++KETFRLHPSTPLSLPRMAAESCEI+GYHIPK +TLLVNVWAI+RDP+ W PLEFRP RFLPG E+ + D++GNDFE IPFGAGRRICAGMSLGLRMV LLTATLVHA++W+LP+G + EKLNMDEAYGLTLQRAAPLMVHP PRLS V+
Sbjct: 297 NLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRGRLVTDLDLPQLTYLQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEKPLEFRPSRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF 507

Q2UYU6_VITVI7.94973e-9779.62%
Flavonoid-3'-hydroxylase OS=Vitis vinifera PE=2 SV=1
HSP 1
Score: 356.681 bits (914), Expect = 7.94973e-97
Identity = 168/211 (79.62%), Postives = 192/211 (91.00%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVY 634
N+FTAGTDTSSSTVEWA+AELIRHP+++AQ QQELD+VVGR RLV +LDL QLTY+QA++KETFRLHPSTPLSLPRMAAESCEI+GYHIPK +TLLVNVWAI+RDP+ W PLEFRP RFLPG E+ + D++GNDFE IPFGAGRRICAGMSLGLRMV LLTATLVHA++W+LP+G + EKLNMDEAYGLTLQRAAPLMVHP PRLS V+
Sbjct: 297 NLFTAGTDTSSSTVEWAIAELIRHPEMMAQAQQELDAVVGRSRLVTDLDLPQLTYVQAIIKETFRLHPSTPLSLPRMAAESCEINGYHIPKNATLLVNVWAIARDPEVWEEPLEFRPNRFLPGGERPNADVRGNDFEVIPFGAGRRICAGMSLGLRMVHLLTATLVHAFNWELPEGQVAEKLNMDEAYGLTLQRAAPLMVHPLPRLSPQVF 507

C0LQP6_9ASTR1.03827e-9677.46%
Flavonoid 3'-hydroxylase OS=Echinops bannaticus PE=2 SV=1
HSP 1
Score: 356.295 bits (913), Expect = 1.03827e-96
Identity = 165/213 (77.46%), Postives = 196/213 (92.02%), Query Frame = 2
Query:    2 NMFTAGTDTSSSTVEWALAELIRHPKILAQVQQELDSVVGRDRLVGELDLAQLTYLQAVVKETFRLHPSTPLSLPRMAAESCEIDGYHIPKGSTLLVNVWAISRDPKQWTNPLEFRPERFLPGSEKAHVDIKGNDFEXIPFGAGRRICAGMSLGLRMVQLLTATLVHAYDWDLPDGLMPEKLNMDEAYGLTLQRAAPLMVHPWPRLSSHVYRA 640
N+F AGTDTSSSTVEWA+AELIRHP++L Q Q+E+D++VGRDRLV E+DL++LT+LQA+VKE FRLHPSTPLSLPR+A+++CE+DGY+IPKGSTLLVNVWAISRDPK W+NPLEF+P RFLPG EK D+KGNDFE IPFGAGRRICAGMSLGL+MVQLLTATLVHA+DW+L +GL P+KLNM+EAYGLTLQRA PLMVHP PRL+ HVY++
Sbjct: 295 NLFAAGTDTSSSTVEWAIAELIRHPQLLKQAQEEMDTIVGRDRLVTEVDLSRLTFLQAIVKEIFRLHPSTPLSLPRIASDTCEVDGYYIPKGSTLLVNVWAISRDPKIWSNPLEFQPTRFLPGGEKPDADVKGNDFELIPFGAGRRICAGMSLGLKMVQLLTATLVHAFDWELANGLDPDKLNMEEAYGLTLQRATPLMVHPRPRLAPHVYQS 507