AC454_contig11737_v2
| Name | AC454_contig11737_v2 |
|---|---|
| Accession | ID2007751 |
| Sequence | CGGCTCCATTATAGGTTTCGaAAAAgGGGTATGGAGTTTCATGCTGTACG |
| Length | 271 |
| Type | contig |
| Organism | American Chestnut |
[-] Collapse All
References
| Dababase | Accession |
|---|---|
| GFF_source | SeqManPro |
Loading...
Alignment Viewer
ESTs in this contig
| Type | Feature | Position |
|---|---|---|
| EST | ACWP1_078777_2352_2089 | 0-271 |
| EST | ACWP2_036866_3962_1400 | 10-265 |
InterProScan Analysis
Analysis Date: 11-03-2009
(Interpro: AC454_contigs_v2)
| ||||||||||||
Loading...

Blast Hits to Uniprot
Analysis Date: 11-03-2009 (Blast: AC454_v2_uniprot)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
B9REN1_RICCO | 3.6264e-19 | 74.36% | ||
Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1776390 PE=4 SV=1 | ||||
HSP 1 Score: 68.1662 bits (165), Expect = 3.6264e-19 Query: 1 ISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 117 HSP 2 Score: 50.0618 bits (118), Expect = 3.6264e-19 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 | ||||
A7QR84_VITVI | 1.61836e-15 | 64.29% | ||
Chromosome chr13 scaffold_149, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00003717001 PE=4 SV=1 | ||||
HSP 1 Score: 62.7734 bits (151), Expect = 1.61836e-15 Query: 1 MSIISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 126 HSP 2 Score: 43.1282 bits (100), Expect = 1.61836e-15 Query: 158 GSLSFLDKISCGLAVYVLQSFQSCSP 235 | ||||
Q8L7Z7_ARATH | 1.73852e-12 | 81.48% | ||
AT3g60070/T2O9_50 OS=Arabidopsis thaliana PE=2 SV=1 | ||||
HSP 1 Score: 49.2914 bits (116), Expect = 1.73852e-12 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 2 Score: 45.0542 bits (105), Expect = 1.73852e-12 Query: 7 ISVTRFGLGLLPSFCALIGVAVTYSMKLHT--PFSKPIM 117 HSP 3 Score: 20.7866 bits (42), Expect = 1.73852e-12 Query: 219 GRNLGGCAFVLWIIELL 269 | ||||
Q9M1D6_ARATH | 1.74206e-12 | 81.48% | ||
Putative uncharacterized protein T2O9.50 OS=Arabidopsis thaliana GN=T2O9.50 PE=4 SV=1 | ||||
HSP 1 Score: 49.2914 bits (116), Expect = 1.74206e-12 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 2 Score: 45.0542 bits (105), Expect = 1.74206e-12 Query: 7 ISVTRFGLGLLPSFCALIGVAVTYSMKLHT--PFSKPIM 117 HSP 3 Score: 20.7866 bits (42), Expect = 1.74206e-12 Query: 219 GRNLGGCAFVLWIIELL 269 | ||||
A5B703_VITVI | 1.04408e-11 | 46.84% | ||
Putative uncharacterized protein (Fragment) OS=Vitis vinifera GN=VITISV_016657 PE=4 SV=1 | ||||
HSP 1 Score: 72.7886 bits (177), Expect = 1.04408e-11 Query: 2 GSLSFLDKISCGLAVYVLQSFQSCSPVNFS*RTNAINVY-YFSYTVWFGSLTVILCTNWGGSYVQHETPYPFFETYNGA 235 | ||||
A2Q3C2_MEDTR | 4.90044e-11 | 73.08% | ||
C19orf28 protein, related OS=Medicago truncatula GN=MtrDRAFT_AC155880g32v2 PE=4 SV=1 | ||||
HSP 1 Score: 46.2098 bits (108), Expect = 4.90044e-11 Query: 158 GSLSFLDKISCGLAVYVLQSFQSCSP 235 HSP 2 Score: 40.817 bits (94), Expect = 4.90044e-11 Query: 25 SVTRFGLGLLPSFCALIGVAVTYSMKLHTP 114 HSP 3 Score: 23.0978 bits (48), Expect = 4.90044e-11 Query: 219 GRNLGGCAFVLWIIELL 269 | ||||
Loading...

Blast Hits to Contigs V2 AB454
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_AB454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
AB454_contig480_v2 | 1.04648e-19 | 88.89% | ||
AB454_contig480_v2 | ||||
HSP 1 Score: 61.0927 bits (127), Expect = 1.04648e-19 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 2 Score: 34.9748 bits (70), Expect = 1.04648e-19 Query: 79 REQMQ*MSIISVTRFGLGLLPS 144 HSP 3 Score: 26.727 bits (52), Expect = 1.04648e-19 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 4 Score: 60.1762 bits (125), Expect = 2.24811e-18 Query: 166 NFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 5 Score: 31.7673 bits (63), Expect = 2.24811e-18 Query: 80 DGKRPKPNRVTEIIDIYCICSLR 148 HSP 6 Score: 26.2688 bits (51), Expect = 2.24811e-18 Query: 238 KTNAQPPRFLP 270 HSP 7 Score: 56.9688 bits (118), Expect = 7.49914e-16 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 8 Score: 29.9345 bits (59), Expect = 7.49914e-16 Query: 81 ENKCNKCLLFQLHGLVWVSYR 143 HSP 9 Score: 22.6031 bits (43), Expect = 7.49914e-16 Query: 241 ESWWLCIC 264 HSP 10 Score: 56.5106 bits (117), Expect = 1.23472e-13 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 11 Score: 29.9345 bits (59), Expect = 1.23472e-13 Query: 80 RTNAINVYYFSYTVWFGSLTV 142 HSP 12 Score: 53.3031 bits (110), Expect = 4.45954e-13 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 13 Score: 23.9778 bits (46), Expect = 4.45954e-13 Query: 239 KQMHSHQDS 265 HSP 14 Score: 22.6031 bits (43), Expect = 4.45954e-13 Query: 81 TVRDPNQTV*LK**TFIAFVL* 146 | ||||
Loading...

Blast Hits to Contigs V2 ABall
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_ABall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
ABall_contig499_v2 | 1.06627e-19 | 88.89% | ||
ABall_contig499_v2 | ||||
HSP 1 Score: 61.0927 bits (127), Expect = 1.06627e-19 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 2 Score: 34.9748 bits (70), Expect = 1.06627e-19 Query: 79 REQMQ*MSIISVTRFGLGLLPS 144 HSP 3 Score: 26.727 bits (52), Expect = 1.06627e-19 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 4 Score: 60.1762 bits (125), Expect = 2.29061e-18 Query: 166 NFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 5 Score: 31.7673 bits (63), Expect = 2.29061e-18 Query: 80 DGKRPKPNRVTEIIDIYCICSLR 148 HSP 6 Score: 26.2688 bits (51), Expect = 2.29061e-18 Query: 238 KTNAQPPRFLP 270 HSP 7 Score: 56.9688 bits (118), Expect = 7.64093e-16 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 8 Score: 29.9345 bits (59), Expect = 7.64093e-16 Query: 81 ENKCNKCLLFQLHGLVWVSYR 143 HSP 9 Score: 22.6031 bits (43), Expect = 7.64093e-16 Query: 241 ESWWLCIC 264 HSP 10 Score: 56.5106 bits (117), Expect = 1.25806e-13 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 11 Score: 29.9345 bits (59), Expect = 1.25806e-13 Query: 80 RTNAINVYYFSYTVWFGSLTV 142 HSP 12 Score: 53.3031 bits (110), Expect = 4.54386e-13 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 13 Score: 23.9778 bits (46), Expect = 4.54386e-13 Query: 239 KQMHSHQDS 265 HSP 14 Score: 22.6031 bits (43), Expect = 4.54386e-13 Query: 81 TVRDPNQTV*LK**TFIAFVL* 146 | ||||
Loading...

Blast Hits to Contigs V2 CC454
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_CC454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CC454_contig28239_v2 | 4.05253e-43 | 94.87% | ||
CC454_contig28239_v2 | ||||
HSP 1 Score: 105.539 bits (224), Expect = 4.05253e-43 Query: 2 YFSYTVWFGSLTVILCTNWGGSYVQHETPYPFFETYNGA 118 HSP 2 Score: 65.2165 bits (136), Expect = 4.05253e-43 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 3 Score: 29.0181 bits (57), Expect = 4.05253e-43 Query: 241 ESWWLCIC 264 HSP 4 Score: 24.8942 bits (48), Expect = 4.05253e-43 Query: 114 ENKCNKCLLF 143 HSP 5 Score: 92.709 bits (196), Expect = 3.66806e-40 Query: 1 RLHYRFRKRGMEFHAVRNCHPN*CTK*R*ETQTKPCN*N 117 HSP 6 Score: 68.424 bits (143), Expect = 3.66806e-40 Query: 160 ESNFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 7 Score: 27.1852 bits (53), Expect = 3.66806e-40 Query: 119 IDIYCICSLR 148 HSP 8 Score: 26.2688 bits (51), Expect = 3.66806e-40 Query: 238 KTNAQPPRFLP 270 HSP 9 Score: 95.0001 bits (201), Expect = 2.03844e-38 Query: 1 ISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 117 HSP 10 Score: 65.2165 bits (136), Expect = 2.03844e-38 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 11 Score: 26.727 bits (52), Expect = 2.03844e-38 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 12 Score: 21.6867 bits (41), Expect = 2.03844e-38 Query: 109 LQLTFLREQMQ*MSIISV 162 HSP 13 Score: 90.8762 bits (192), Expect = 4.49933e-34 Query: 3 LFQLHGLVWVSYRHFVH*LGWQLRTA*NSIPLFRNL*WS 119 HSP 14 Score: 64.7583 bits (135), Expect = 4.49933e-34 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 15 Score: 22.1449 bits (42), Expect = 4.49933e-34 Query: 239 GGILVAVHLF 268 HSP 16 Score: 91.7926 bits (194), Expect = 1.14368e-33 Query: 2 GSIIGFEKGVWSFMLYVTATPISAQNDGKRPKPNRVTEI 118 HSP 17 Score: 58.8016 bits (122), Expect = 1.14368e-33 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 18 Score: 25.8106 bits (50), Expect = 1.14368e-33 Query: 239 KQMHSHQDS 265 HSP 19 Score: 84.9195 bits (179), Expect = 4.37403e-30 Query: 3 APL*VSKKGYGVSCCT*LPPQLVHKMTVRDPNQTV*LK 116 HSP 20 Score: 61.5509 bits (128), Expect = 4.37403e-30 Query: 156 TGEQLWKD*RT*TASPHEILSKKLNDPQNKCTATKIPP 269 | ||||
Loading...

Blast Hits to Contigs V2 CCall
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_CCall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
CCall_contig44975_v2 | 4.205e-43 | 94.87% | ||
CCall_contig44975_v2 | ||||
HSP 1 Score: 105.539 bits (224), Expect = 4.205e-43 Query: 2 YFSYTVWFGSLTVILCTNWGGSYVQHETPYPFFETYNGA 118 HSP 2 Score: 65.2165 bits (136), Expect = 4.205e-43 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 3 Score: 29.0181 bits (57), Expect = 4.205e-43 Query: 241 ESWWLCIC 264 HSP 4 Score: 24.8942 bits (48), Expect = 4.205e-43 Query: 114 ENKCNKCLLF 143 HSP 5 Score: 92.709 bits (196), Expect = 3.80607e-40 Query: 1 RLHYRFRKRGMEFHAVRNCHPN*CTK*R*ETQTKPCN*N 117 HSP 6 Score: 68.424 bits (143), Expect = 3.80607e-40 Query: 160 ESNFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 7 Score: 27.1852 bits (53), Expect = 3.80607e-40 Query: 119 IDIYCICSLR 148 HSP 8 Score: 26.2688 bits (51), Expect = 3.80607e-40 Query: 238 KTNAQPPRFLP 270 HSP 9 Score: 95.0001 bits (201), Expect = 2.11514e-38 Query: 1 ISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 117 HSP 10 Score: 65.2165 bits (136), Expect = 2.11514e-38 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 11 Score: 26.727 bits (52), Expect = 2.11514e-38 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 12 Score: 21.6867 bits (41), Expect = 2.11514e-38 Query: 109 LQLTFLREQMQ*MSIISV 162 HSP 13 Score: 90.8762 bits (192), Expect = 4.66862e-34 Query: 3 LFQLHGLVWVSYRHFVH*LGWQLRTA*NSIPLFRNL*WS 119 HSP 14 Score: 64.7583 bits (135), Expect = 4.66862e-34 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 15 Score: 22.1449 bits (42), Expect = 4.66862e-34 Query: 239 GGILVAVHLF 268 HSP 16 Score: 91.7926 bits (194), Expect = 1.18671e-33 Query: 2 GSIIGFEKGVWSFMLYVTATPISAQNDGKRPKPNRVTEI 118 HSP 17 Score: 58.8016 bits (122), Expect = 1.18671e-33 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 18 Score: 25.8106 bits (50), Expect = 1.18671e-33 Query: 239 KQMHSHQDS 265 HSP 19 Score: 84.9195 bits (179), Expect = 4.5386e-30 Query: 3 APL*VSKKGYGVSCCT*LPPQLVHKMTVRDPNQTV*LK 116 HSP 20 Score: 61.5509 bits (128), Expect = 4.5386e-30 Query: 156 TGEQLWKD*RT*TASPHEILSKKLNDPQNKCTATKIPP 269 | ||||
Loading...

Blast Hits to MedicagoProt
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_MedicagoProt_20080227)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
IMGA|AC155880_42.5 C19orf28 protein, identical chr02_p | 2.93131e-13 | 73.08% | ||
eudomolecule_IMGAG_V2 15050253-15058515 E EGN_Mt071002 20080227 | ||||
HSP 1 Score: 46.2098 bits (108), Expect = 2.93131e-13 Query: 158 GSLSFLDKISCGLAVYVLQSFQSCSP 235 HSP 2 Score: 40.817 bits (94), Expect = 2.93131e-13 Query: 25 SVTRFGLGLLPSFCALIGVAVTYSMKLHTP 114 HSP 3 Score: 23.0978 bits (48), Expect = 2.93131e-13 Query: 219 GRNLGGCAFVLWIIELL 269 | ||||
Loading...

Blast Hits to Contig V2 Oall
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_Oall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
Oall_contig13463_v2 | 7.62849e-46 | 100.00% | ||
Oall_contig13463_v2 | ||||
HSP 1 Score: 107.372 bits (228), Expect = 7.62849e-46 Query: 2 YFSYTVWFGSLTVILCTNWGGSYVQHETPYPFFETYNGA 118 HSP 2 Score: 66.5912 bits (139), Expect = 7.62849e-46 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 3 Score: 29.0181 bits (57), Expect = 7.62849e-46 Query: 241 ESWWLCIC 264 HSP 4 Score: 27.6434 bits (54), Expect = 7.62849e-46 Query: 114 ENKCNKCLLF 143 HSP 5 Score: 99.124 bits (210), Expect = 3.27468e-42 Query: 1 RLHYRFRKRGMEFHAVRNCHPN*CTK*R*ETQTKPCN*N 117 HSP 6 Score: 65.6747 bits (137), Expect = 3.27468e-42 Query: 160 ESNFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 7 Score: 27.1852 bits (53), Expect = 3.27468e-42 Query: 119 IDIYCICSLR 148 HSP 8 Score: 26.2688 bits (51), Expect = 3.27468e-42 Query: 238 KTNAQPPRFLP 270 HSP 9 Score: 96.3747 bits (204), Expect = 4.02071e-39 Query: 3 LFQLHGLVWVSYRHFVH*LGWQLRTA*NSIPLFRNL*WS 119 HSP 10 Score: 62.9255 bits (131), Expect = 4.02071e-39 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 11 Score: 26.727 bits (52), Expect = 4.02071e-39 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 12 Score: 21.6867 bits (41), Expect = 4.02071e-39 Query: 119 RTNAINVY 142 HSP 13 Score: 96.8329 bits (205), Expect = 8.40335e-36 Query: 2 GSIIGFEKGVWSFMLYVTATPISAQNDGKRPKPNRVTEI 118 HSP 14 Score: 58.3434 bits (121), Expect = 8.40335e-36 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 15 Score: 25.8106 bits (50), Expect = 8.40335e-36 Query: 239 KQMHSHQDS 265 HSP 16 Score: 95.0001 bits (201), Expect = 1.56594e-35 Query: 1 ISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 117 HSP 17 Score: 62.9255 bits (131), Expect = 1.56594e-35 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 18 Score: 22.1449 bits (42), Expect = 1.56594e-35 Query: 239 GGILVAVHLF 268 HSP 19 Score: 90.418 bits (191), Expect = 7.21961e-32 Query: 3 APL*VSKKGYGVSCCT*LPPQLVHKMTVRDPNQTV*LK 116 HSP 20 Score: 60.6344 bits (126), Expect = 7.21961e-32 Query: 156 TGEQLWKD*RT*TASPHEILSKKLNDPQNKCTATKIPP 269 | ||||
Loading...

Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_PopulusProt_JamboreeModels1_1)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
fgenesh4_pg.C_LG_IX001320 | 2.32663e-11 | 52.11% | ||
jgi|Poptr1_1|768269|fgenesh4_pg.C_LG_IX001320 | ||||
HSP 1 Score: 63.929 bits (154), Expect = 2.32663e-11 Query: 1 GLPFMFFSLS---KVALQLT-FLREQMQ*MSIISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 201 | ||||
Loading...

Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_TAIR7_pep_20070425)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
AT3G60070.1 | 1.49128e-14 | 81.48% | ||
lactose permease-related | chr3:22194554-22196917 REVERSE | ||||
HSP 1 Score: 49.2914 bits (116), Expect = 1.49128e-14 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 2 Score: 45.0542 bits (105), Expect = 1.49128e-14 Query: 7 ISVTRFGLGLLPSFCALIGVAVTYSMKLHT--PFSKPIM 117 HSP 3 Score: 20.7866 bits (42), Expect = 1.49128e-14 Query: 219 GRNLGGCAFVLWIIELL 269 | ||||
Loading...

Blast Hits to Contigs V2 WO454
Analysis Date: 11-03-2009 (Blast: AC454_contigs_v2_vs_WO454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
WO454_contig11954_v2 | 2.22787e-46 | 100.00% | ||
WO454_contig11954_v2 | ||||
HSP 1 Score: 107.372 bits (228), Expect = 2.22787e-46 Query: 2 YFSYTVWFGSLTVILCTNWGGSYVQHETPYPFFETYNGA 118 HSP 2 Score: 66.5912 bits (139), Expect = 2.22787e-46 Query: 158 CGSLSFLDKISCGLAVYVLQSFQSCSP 238 HSP 3 Score: 29.0181 bits (57), Expect = 2.22787e-46 Query: 241 ESWWLCIC 264 HSP 4 Score: 27.6434 bits (54), Expect = 2.22787e-46 Query: 114 ENKCNKCLLF 143 HSP 5 Score: 99.124 bits (210), Expect = 9.57411e-43 Query: 1 RLHYRFRKRGMEFHAVRNCHPN*CTK*R*ETQTKPCN*N 117 HSP 6 Score: 65.6747 bits (137), Expect = 9.57411e-43 Query: 160 ESNFGKTEEHKRQAHMRFCPRSSMIHK 240 HSP 7 Score: 27.1852 bits (53), Expect = 9.57411e-43 Query: 119 IDIYCICSLR 148 HSP 8 Score: 26.2688 bits (51), Expect = 9.57411e-43 Query: 238 KTNAQPPRFLP 270 HSP 9 Score: 96.3747 bits (204), Expect = 1.17679e-39 Query: 3 LFQLHGLVWVSYRHFVH*LGWQLRTA*NSIPLFRNL*WS 119 HSP 10 Score: 62.9255 bits (131), Expect = 1.17679e-39 Query: 159 LWIIELLGQNLMWACRLCSSVFPKLLS 239 HSP 11 Score: 26.727 bits (52), Expect = 1.17679e-39 Query: 219 GRNLGGCAFVLWIIELL 269 HSP 12 Score: 21.6867 bits (41), Expect = 1.17679e-39 Query: 119 RTNAINVY 142 HSP 13 Score: 96.8329 bits (205), Expect = 2.8648e-36 Query: 2 GSIIGFEKGVWSFMLYVTATPISAQNDGKRPKPNRVTEI 118 HSP 14 Score: 58.3434 bits (121), Expect = 2.8648e-36 Query: 158 WRATLERLKNINGKPT*DFVQEAQ*STKQ 244 HSP 15 Score: 25.8106 bits (50), Expect = 2.8648e-36 Query: 239 KQMHSHQDS 265 HSP 16 Score: 95.0001 bits (201), Expect = 2.58349e-34 Query: 1 ISVTRFGLGLLPSFCALIGVAVTYSMKLHTPFSKPIMEP 117 HSP 17 Score: 62.9255 bits (131), Expect = 2.58349e-34 Query: 157 FVDH*ASWTKSHVGLPFMFFSLSKVALQ 240 HSP 18 Score: 90.418 bits (191), Expect = 2.87197e-32 Query: 3 APL*VSKKGYGVSCCT*LPPQLVHKMTVRDPNQTV*LK 116 HSP 19 Score: 60.6344 bits (126), Expect = 2.87197e-32 Query: 156 TGEQLWKD*RT*TASPHEILSKKLNDPQNKCTATKIPP 269 | ||||
tags