AB454_contig6053_v2
| Name | AB454_contig6053_v2 |
|---|---|
| Accession | ID1838403 |
| Sequence | CGAAACGCTGCGTATAAGCGCGAATCTCGCTTCTTCAAATTCAAACGCAA |
| Length | 327 |
| Type | contig |
| Organism | American Beech |
[-] Collapse All
References
| Dababase | Accession |
|---|---|
| GFF_source | SeqManPro |
Loading...
Alignment Viewer
ESTs in this contig
| Type | Feature | Position |
|---|---|---|
| EST | ABWP1_018068_0542_2657 | 0-254 |
| EST | ABWP1_013431_0579_2277 | 83-327 |
InterProScan Analysis
Analysis Date: 11-02-2009
(Interpro: AB454_contigs_v2)
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Loading...

Blast Hits to Uniprot
Analysis Date: 11-02-2009 (Blast: AB454_v2_uniprot)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
B9SIQ0_RICCO | 7.43709e-16 | 85.19% | ||
Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0825020 PE=4 SV=1 | ||||
HSP 1 Score: 54.6842 bits (130), Expect = 7.43709e-16 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAE 206 HSP 2 Score: 52.373 bits (124), Expect = 7.43709e-16 Query: 221 GTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 | ||||
A7QCD7_VITVI | 2.92306e-14 | 63.89% | ||
Chromosome undetermined scaffold_77, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00035355001 PE=4 SV=1 | ||||
HSP 1 Score: 51.6026 bits (122), Expect = 2.92306e-14 Query: 218 SGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 50.0618 bits (118), Expect = 2.92306e-14 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAE 206 | ||||
A5AUK4_VITVI | 2.92685e-14 | 63.89% | ||
Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_003254 PE=4 SV=1 | ||||
HSP 1 Score: 51.6026 bits (122), Expect = 2.92685e-14 Query: 218 SGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 50.0618 bits (118), Expect = 2.92685e-14 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAE 206 | ||||
Q93YU2_ARATH | 9.25723e-12 | 50.00% | ||
Putative uncharacterized protein At5g49820 OS=Arabidopsis thaliana GN=At5g49820 PE=2 SV=1 | ||||
HSP 1 Score: 47.7506 bits (112), Expect = 9.25723e-12 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 45.4394 bits (106), Expect = 9.25723e-12 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAE 206 | ||||
Loading...

Blast Hits to Contigs V2 ABall
Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_ABall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
ABall_contig6146_v2 | 1.71891e-56 | 88.89% | ||
ABall_contig6146_v2 | ||||
HSP 1 Score: 211.843 bits (456), Expect = 1.71891e-56 Query: 2 TFWNHIRSYE*H*ILNGSWRSVHSEGANGALPEGSREGAFSAT*FHLRPSISSQQISLKLEFTYXXXXXXXXXXXXTLXLHRIS*RERW*FRCV*I*RSEIRAYTQRF 325 HSP 2 Score: 164.648 bits (353), Expect = 3.66027e-56 Query: 120 NLLEPHTILRMTLDPQRELEECA**GREWSPS*RFQRGSFFCHVVPSTTVDFLAANQPQA*IHVLFLYQ 326 HSP 3 Score: 65.0265 bits (137), Expect = 3.66027e-56 Query: 1 STESAKESGGDSVAFEFEEARFALIRSVS 87 HSP 4 Score: 166.022 bits (356), Expect = 4.98746e-54 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAEKAPSLEPSGRAPFAPSLCTLLQLPLRI*CHS*DRMWFQKV 326 HSP 5 Score: 56.5106 bits (117), Expect = 4.98746e-54 Query: 1 RNAAYKRESRFFKFKRNGITTAL 69 HSP 6 Score: 162.357 bits (348), Expect = 7.73473e-52 Query: 121 W*RKST*IQA*G*FAARKSTVVDGTTWQKKLPLWNLQEGLHSRPHYAHSSSSR*GSNVIRKIVCGSRRF 327 HSP 7 Score: 52.8449 bits (109), Expect = 7.73473e-52 Query: 3 KRCV*ARISLLQIQTQRNHHRS 68 HSP 8 Score: 152.92 bits (331), Expect = 2.40158e-51 Query: 133 KPSGTTYDLTNDIRSSTGAGGVCIVRARMEPFLKVPERELFLPRSSIYDRRFPRSKSASSLNSRT 327 HSP 9 Score: 60.6344 bits (126), Expect = 2.40158e-51 Query: 3 NQLKRAVVIPLRLNLKKRDSRLYAAF 80 HSP 10 Score: 175.645 bits (377), Expect = 1.35544e-45 Query: 2 ETLRIXXXXXXXXXXXTESPPLSLADSVEXQSXXXXXXXXXXXXXXEFKLEADLLRGNRRS*MELRGRKSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 | ||||
Loading...

Blast Hits to MedicagoProt
Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_MedicagoProt_20080227)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
IMGA|AC144806_8.4 Protein of unknown function DUF647 chr04_p | 8.32811e-15 | 47.50% | ||
eudomolecule_IMGAG_V2 20685580-20692547 E EGN_Mt071002 20080227 | ||||
HSP 1 Score: 48.521 bits (114), Expect = 8.32811e-15 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 46.595 bits (109), Expect = 8.32811e-15 Query: 144 SSLRLICCEEIDGRRWNYVAE 206 | ||||
Loading...

Blast Hits to Contig V2 Oall
Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_Oall_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
Oall_contig9807_v2 | 3.63506e-29 | 96.43% | ||
Oall_contig9807_v2 | ||||
HSP 1 Score: 68.424 bits (143), Expect = 3.63506e-29 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAEK 209 HSP 2 Score: 67.5076 bits (141), Expect = 3.63506e-29 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPE 322 HSP 3 Score: 21.6867 bits (41), Expect = 3.63506e-29 Query: 30 LLQIQTQRNHHR 65 HSP 4 Score: 65.2165 bits (136), Expect = 1.56136e-22 Query: 120 FFCHVVPSTTVDFLAANQPQA*IHVLFLYQ 209 HSP 5 Score: 54.2195 bits (112), Expect = 1.56136e-22 Query: 204 LLEPHTILRMTLDPQRELEECA**GREWSPS*RFQRGSFF 323 HSP 6 Score: 62.0091 bits (129), Expect = 2.13474e-22 Query: 202 QKKLPLWNLQEGLHSRPHYAHSSSSR*GSNVIRKIVCGSR 321 HSP 7 Score: 56.9688 bits (118), Expect = 2.13474e-22 Query: 121 W*RKST*IQA*G*FAARKSTVVDGTTWQKK 210 HSP 8 Score: 50.9817 bits (106), Expect = 4.29614e-17 Query: 205 SGTTYDLTNDIRSSTGAGGVCIVRARMEPFLKVPERELF 321 HSP 9 Score: 50.0756 bits (104), Expect = 4.29614e-17 Query: 133 LFLPRSSIYDRRFPRSKSASSLNSRT 210 HSP 10 Score: 52.8449 bits (109), Expect = 7.7417e-17 Query: 204 EKAPSLEPSGRAPFAPSLCTLLQLPLRI*CHS*DRMWFQK 323 HSP 11 Score: 47.3464 bits (97), Expect = 7.7417e-17 Query: 140 EFKLEADLLRGNRRS*MELRGRK 208 | ||||
Oall_contig13459_v2 | 8.69035e-23 | 82.50% | ||
Oall_contig13459_v2 | ||||
HSP 1 Score: 81.712 bits (172), Expect = 8.69035e-23 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 38.6404 bits (78), Expect = 8.69035e-23 Query: 168 EEIDGRRWNYVAEK 209 HSP 3 Score: 71.3694 bits (151), Expect = 1.05539e-17 Query: 205 KPSGTTYDLTNDIRSSTGAGGVCIVRARMEPFLKVPERELF 327 HSP 4 Score: 31.7673 bits (63), Expect = 1.05539e-17 Query: 170 AFSAT*FHLRPSIS 211 HSP 5 Score: 70.2568 bits (147), Expect = 1.69519e-17 Query: 204 EKAPSLEPSGRAPFAPSLCTLLQLPLRI*CHS*DRMWFQKV 326 HSP 6 Score: 32.2255 bits (64), Expect = 1.69519e-17 Query: 169 RKSTVVDGTTWQKK 210 HSP 7 Score: 67.5076 bits (141), Expect = 1.45936e-16 Query: 206 TFWNHIRSYE*H*ILNGSWRSVHSEGANGALPEGSREGAF 325 HSP 8 Score: 31.7673 bits (63), Expect = 1.45936e-16 Query: 168 FFCHVVPSTTVDFL 209 HSP 9 Score: 65.6747 bits (137), Expect = 2.08284e-15 Query: 204 NLLEPHTILRMTLDPQRELEECA**GREWSPS*RFQRGSFF 326 HSP 10 Score: 29.6879 bits (59), Expect = 2.08284e-15 Query: 169 LFLPRSSIYDRRFP 210 HSP 11 Score: 70.2568 bits (147), Expect = 2.47448e-15 Query: 205 KKLPLWNLQEGLHSRPHYAHSSSSR*GSNVIRKIVCGSRRF 327 HSP 12 Score: 24.8942 bits (48), Expect = 2.47448e-15 Query: 170 GNRRS*MELRGRK 208 | ||||
Loading...

Blast Hits to Contig V2 RO454
Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_RO454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
RO454_contig6459_v2 | 2.27595e-29 | 96.43% | ||
RO454_contig6459_v2 | ||||
HSP 1 Score: 68.424 bits (143), Expect = 2.27595e-29 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAEK 209 HSP 2 Score: 67.5076 bits (141), Expect = 2.27595e-29 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPE 322 HSP 3 Score: 21.6867 bits (41), Expect = 2.27595e-29 Query: 30 LLQIQTQRNHHR 65 HSP 4 Score: 65.2165 bits (136), Expect = 9.63981e-23 Query: 120 FFCHVVPSTTVDFLAANQPQA*IHVLFLYQ 209 HSP 5 Score: 54.2195 bits (112), Expect = 9.63981e-23 Query: 204 LLEPHTILRMTLDPQRELEECA**GREWSPS*RFQRGSFF 323 HSP 6 Score: 62.0091 bits (129), Expect = 1.31798e-22 Query: 202 QKKLPLWNLQEGLHSRPHYAHSSSSR*GSNVIRKIVCGSR 321 HSP 7 Score: 56.9688 bits (118), Expect = 1.31798e-22 Query: 121 W*RKST*IQA*G*FAARKSTVVDGTTWQKK 210 HSP 8 Score: 50.9817 bits (106), Expect = 2.65216e-17 Query: 205 SGTTYDLTNDIRSSTGAGGVCIVRARMEPFLKVPERELF 321 HSP 9 Score: 50.0756 bits (104), Expect = 2.65216e-17 Query: 133 LFLPRSSIYDRRFPRSKSASSLNSRT 210 HSP 10 Score: 52.8449 bits (109), Expect = 4.77919e-17 Query: 204 EKAPSLEPSGRAPFAPSLCTLLQLPLRI*CHS*DRMWFQK 323 HSP 11 Score: 47.3464 bits (97), Expect = 4.77919e-17 Query: 140 EFKLEADLLRGNRRS*MELRGRK 208 | ||||
Loading...

Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_TAIR7_pep_20070425)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
AT5G49820.1 | 4.32221e-14 | 50.00% | ||
EMB1879 (EMBRYO DEFECTIVE 1879) | chr5:20263979-20266658 REVERSE | ||||
HSP 1 Score: 47.7506 bits (112), Expect = 4.32221e-14 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 45.4394 bits (106), Expect = 4.32221e-14 Query: 126 EEEYVNSSLRLICCEEIDGRRWNYVAE 206 | ||||
Loading...

Blast Hits to Contigs V2 WO454
Analysis Date: 11-02-2009 (Blast: AB454_contigs_v2_vs_WO454_contigs_v2)
Best 10 Hits Shown
Note: Click a description for more details.
Best 10 Hits Shown
Note: Click a description for more details.
| Match Name | E value | Identity | ||
|---|---|---|---|---|
WO454_contig6803_v2 | 4.15749e-23 | 82.50% | ||
WO454_contig6803_v2 | ||||
HSP 1 Score: 81.712 bits (172), Expect = 4.15749e-23 Query: 206 KSSLSGTFRKGSIRALTMHTPPAPVEDLMSFVRSYVVPEG 325 HSP 2 Score: 38.6404 bits (78), Expect = 4.15749e-23 Query: 168 EEIDGRRWNYVAEK 209 HSP 3 Score: 71.3694 bits (151), Expect = 5.05179e-18 Query: 205 KPSGTTYDLTNDIRSSTGAGGVCIVRARMEPFLKVPERELF 327 HSP 4 Score: 31.7673 bits (63), Expect = 5.05179e-18 Query: 170 AFSAT*FHLRPSIS 211 HSP 5 Score: 70.2568 bits (147), Expect = 8.10765e-18 Query: 204 EKAPSLEPSGRAPFAPSLCTLLQLPLRI*CHS*DRMWFQKV 326 HSP 6 Score: 32.2255 bits (64), Expect = 8.10765e-18 Query: 169 RKSTVVDGTTWQKK 210 HSP 7 Score: 67.5076 bits (141), Expect = 6.98496e-17 Query: 206 TFWNHIRSYE*H*ILNGSWRSVHSEGANGALPEGSREGAF 325 HSP 8 Score: 31.7673 bits (63), Expect = 6.98496e-17 Query: 168 FFCHVVPSTTVDFL 209 HSP 9 Score: 65.6747 bits (137), Expect = 9.96827e-16 Query: 204 NLLEPHTILRMTLDPQRELEECA**GREWSPS*RFQRGSFF 326 HSP 10 Score: 29.6879 bits (59), Expect = 9.96827e-16 Query: 169 LFLPRSSIYDRRFP 210 HSP 11 Score: 70.2568 bits (147), Expect = 1.1833e-15 Query: 205 KKLPLWNLQEGLHSRPHYAHSSSSR*GSNVIRKIVCGSRRF 327 HSP 12 Score: 24.8942 bits (48), Expect = 1.1833e-15 Query: 170 GNRRS*MELRGRK 208 | ||||
tags